KEGG   Pirellula staleyi: Psta_3344Help
Entry
Psta_3344         CDS       T01147                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psl  Pirellula staleyi
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psta_3344
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Psta_3344
Enzymes [BR:psl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psta_3344
Two-component system [BR:psl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Psta_3344
Bacterial motility proteins [BR:psl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psta_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4331898..4333016
Genome map
AA seq 372 aa AA seqDB search
MTAKIRVLVVDDSTIIRRLVTDILSADPEIEVVGTAPDGQVALAKLGTLAAEVVTLDIEM
PVMDGLETLVHLRKTYPRLPVIMFSTLTSSGAVATLDALARGATDYVTKPANVGSVTEAM
QHVRSLLIPKIKTLARSAHLAALSETRASLSQATPTVHRLATIRPTISKPVVPPTLIGIG
VSTGGPNALAELLPRLPKNLSVPIVVVQHMPPIFTKHLAERLDAVSAVRVVEASDGELLQ
SGSVYLAPGGHHLEVMRGERGLELRIVDTPPENSCRPAVDVLFRSIARTCGAASIGCILT
GMGRDGLKGCEAMVQAGARIFVQDQPSSVVWGMPGVVAEAGLAEKVVPLVGFPFELQQAV
RHSTVAPSLVRS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaagattcgtgtgctggtggtcgacgattcgacgatcattcggcgtcttgtc
accgatattctgtcagccgacccagaaatcgaagtggtcggaactgctcccgatggtcaa
gtagcacttgctaagctcggtacacttgcagccgaagtggtgacgctcgacatcgaaatg
ccggtgatggatggcctcgaaacactcgtgcatttgcgaaaaacgtatccacgtttgccg
gtgatcatgttcagcaccctcacttcgagtggcgcggtggcaactctcgatgcattagcc
cgtggcgcaaccgactatgtcactaaacctgccaatgtcgggagtgtgaccgaagcgatg
cagcatgtccggtcacttttgattccgaagatcaagacactggcgcgaagtgcccatctg
gcggcattaagtgaaactcgagcgagcctttcgcaagccacaccaactgtacatcggcta
gcaacaatcaggccgacgattagcaaaccggtcgtccctcccacattgattgggatcggg
gtttcgaccggtggcccgaatgcgctggccgagctattgccgaggctgccgaagaacctg
tcagtgccaatcgtggtagtgcagcatatgcccccgatatttaccaaacatttagccgag
cgactcgatgctgtctcggcggtgcgtgtggtggaagcgagcgatggcgaattgctgcag
agcggctcggtctatctcgctcccggtggtcaccatttggaagtgatgcgaggcgagcgt
gggctcgagcttcgaatcgtagacacccctcccgaaaactcgtgtcgtccggcagtcgat
gttctgtttcgctcgatcgctcgcacctgtggcgcagcgtcgatcggttgcattttgacg
gggatggggcgcgatggtttgaaggggtgcgaagcgatggtgcaagccggcgctcgcatc
tttgtgcaagatcagccgagcagtgtggtgtggggcatgcctggcgtagtagccgaggcg
ggcctcgcggaaaaagtggtgccactggtcggttttccgtttgagttgcagcaggcagtt
cgccacagtaccgtcgccccctcgctggtcaggagttag

DBGET integrated database retrieval system