KEGG   Pirellula staleyi: Psta_3587Help
Entry
Psta_3587         CDS       T01147                                 

Definition
DNA recombination protein RuvA domain I
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psl  Pirellula staleyi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psta_3587
Enzymes [BR:psl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Psta_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4685753..4686385)
Genome map
AA seq 210 aa AA seqDB search
MITRITAKLIQLTDDAAILSAPPFDYEVLIAAVSRRTLSSSVGQEISLHTIHYLDGDPSR
GKVTPRLVGFVSEVEREFFEMFCSVDGVGAKKALRAMQRPVQEISVMIEEQDAEGLSSLP
GIGAATAERIIAKLRRKMSKFALLVARESAGETEIKRDVVELSFEALRTLGHSESDARKL
LDSVLKSKKKFADVEAVLSAIYQQNQSKSE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ttgattacgcgcatcaccgcgaagctgattcaactcactgacgatgccgccattctctcg
gcaccaccgttcgactacgaagtgctgatcgctgctgtttcgcgtcgcacactttcctcg
agtgttgggcaagagattagtttgcacacgattcactacctcgatggcgacccatcgcgt
ggcaaggtgacgccgcgattagtcggctttgtttctgaagtcgagcgtgaattcttcgag
atgttttgcagtgtcgatggagtaggtgcgaagaaggcgttgcgcgcgatgcagcggccg
gtgcaagaaatctcggtgatgatcgaagagcaagatgcggaaggattgtcgtcgctaccg
ggcattggcgctgcgacagccgaacgaattatcgccaaactgcggcgcaagatgtcgaag
tttgcattgctcgtagcccgcgaatcggctggcgaaaccgagatcaagcgcgatgtagtg
gagctttcgtttgaagcactgcgcacgctcggacatagcgaatctgatgcgcgaaagctg
ctcgattccgtgctgaaatcgaaaaagaagttcgccgacgtcgaagctgttttgtcggcg
atttatcagcaaaaccagtcgaaaagcgagtag

DBGET integrated database retrieval system