KEGG   Pirellula staleyi: Psta_3809Help
Entry
Psta_3809         CDS       T01147                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psl  Pirellula staleyi
Pathway
psl00260  Glycine, serine and threonine metabolism
psl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01130  Biosynthesis of antibiotics
psl01230  Biosynthesis of amino acids
Module
psl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psta_3809
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psta_3809
Enzymes [BR:psl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psta_3809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADB18464
UniProt: D2R0X9
Position
complement(4956823..4957641)
Genome map
AA seq 272 aa AA seqDB search
MSAIDQLFTEYRAAKKKALMPFITAGDPDLAFTADVVRELDRRGCAMCEVGIPYSDPIAD
GPVIQASYTRALAKGVKVKGILDSLASVKSEVKFPRVTMVSYAILHRYGLARYIHDAKQA
GISGAIVPDLLVEESAAAAKLCQEADFSLIQLITPTTPRDRALRIAATSTGFIYYVSVTG
ITGERTQLPPDLIENVSWLRSQTPLPICIGFGISTPEHVNLLAPVADGLIVGSAIVRRMA
TAGEGSRSEVLRGVGDYVSTLLDALHGTTVSA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaatcgatcaactgtttactgaatatcgtgcggcgaagaagaaagccctgatg
ccgtttatcacggcgggcgatcccgatctggcattcacagccgacgtggtccgcgaactc
gatcgccggggctgcgcgatgtgcgaagtcggtattccttacagcgatccgattgccgat
ggtccggtgattcaggcctcgtatacccgcgccctggccaagggggtgaaggtgaagggg
attctcgattcgctcgcgtcggtgaagagcgaggtgaagttcccgcgcgtcacgatggtg
agctatgcgattctgcatcgctacggactagcgcggtatatccacgatgccaagcaggcg
gggatcagcggcgcgattgtgcccgacctgcttgtcgaggaatcggccgcagccgctaaa
ctttgccaagaggccgatttcagcttgattcagctgatcacgccgaccaccccccgcgat
cgcgctttgcgtatcgcagccacgagcaccggctttatctactacgtctcggtcaccggc
atcactggcgagcgaacgcaattgcctcccgatctgatcgagaatgtgagctggctccgc
tcgcaaacgccactgccgatctgcattggttttggcatcagcacgccggagcatgtcaat
cttctcgcgccggtagccgatggtttgattgtcggctcggcgattgtgcgccgcatggcg
actgctggcgagggttcgcgctcggaagtgctgcgcggcgtgggggactatgtgtcgacc
ttgctcgacgcgctgcatggcaccacggtctcggcttag

DBGET integrated database retrieval system