KEGG   Pirellula staleyi: Psta_3812Help
Entry
Psta_3812         CDS       T01147                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
psl  Pirellula staleyi
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:psl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4959386..4960240
Genome map
AA seq 284 aa AA seqDB search
MPELPEVETMRRGILKATGATIVDVQLEPCARRPIAIKPSLAVVQKSLIGTKISAIERLG
KRVVVRAGDDFHLILEPRMTGLVLVSDPPSREHLRLRIDLAGSVLPSIWYWDRRGLGSIQ
LYRTAELEAQLLSGKLGPDALAISKDDFSARLKRTSRAIKVALLDQQIVAGVGNLYASEI
LHLAAIDPKCRANKLTRQQLDLLHDKMLEVLHTAILHEGSTLSDGTYRNALAQAGNYQNM
HRVYDREHEPCPTCLSPIQRIVQAQRSTFFCAACQRPSRKKPLK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactacccgaagtcgaaacgatgcggcgtggcatcttgaaagcaactggcgcc
acgattgtcgacgtccagctcgaaccgtgcgcgaggcgtcccatcgcgatcaaaccgtca
ctcgcagtggttcaaaaatcgctcatcggaaccaagatcagtgcgatcgaacgcctggga
aaacgtgtggtggtgcgcgcgggggacgattttcacctgatcctcgagccgcgcatgacg
ggactcgtgctggtgagcgatcctccgtcgcgcgagcatctacgacttcgcatcgatctc
gccgggagcgtgctcccttcgatttggtactgggatcggcgcgggcttgggagtattcag
ctctaccgcacggcggaactcgaagcgcaactgctctcaggaaaactgggacccgacgcg
cttgcgatttcgaaggacgatttctccgcgaggctgaagcggacgagtcgagccatcaag
gttgcgctgctcgatcagcagatcgtcgcgggagtaggcaatctgtatgcttccgagatt
ttgcatctagcagcgatcgatcccaagtgtcgcgcgaataaactgacgcgacagcagctc
gacctgcttcacgacaagatgctcgaggtacttcataccgccattttgcatgaaggttcg
accttgtccgatggcacttatcgcaacgcacttgcacaggctggcaactaccagaatatg
caccgagtttacgatcgcgagcacgaaccttgcccaacgtgcctgtcacccattcagcgc
attgtgcaagcccagcggtcgacctttttttgcgcagcttgtcagcgtccctctcgtaaa
aaacctctgaaataa

DBGET integrated database retrieval system