KEGG   Pirellula staleyi: Psta_3910Help
Entry
Psta_3910         CDS       T01147                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
psl  Pirellula staleyi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5085657..5087174
Genome map
AA seq 505 aa AA seqDB search
MPDAIIPTQNFRGISLRTVLSQVQFTKGQDIVCSAISTTEVDCEPGDLFIPEAEDHTDLL
SRCQAAIERGAAAILTEQLLPLAIPQAIVPDAREALGIISHAIVGNPSAKMRTIGITGSH
GKTATAMLVASVLEAASQACGVISSLGYSDSIEQVSTKCATPRSPKLAWWMSRMVKNKAA
AAVIEMSSQGLSQRRTAGTSLDIAVLTNLRNVHTSEHGSAANYLAAKKRIFSHLKPGGLA
IINADDHRSRQLLESLACPTLTVGLHAEADISARVIDRSIAEQRFTITAGDETIQVRSRI
IGDAHVANCLSAVAVGLSLGIELSTIVRGIENVTYLPGRMQRLEVGQEFGVIVDAASTPD
TLAIALKTARRVTKGRVLLVFSASGEKNRDARPMLARVAEQGADLAVITSGNPRRESPRE
ITHQLLDGFHRPAKAHFIPTRAEAIRWALGHAQPGDCVLICGHGDRTSHLVGTHKVRHDD
REVALTWLYESGQRELAKPQLKIFG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgctatcattccgacccagaatttccgtggtatttcgctccgaaccgtactt
tcacaagtgcagttcaccaaagggcaggacatcgtttgctccgctatttcgaccaccgaa
gtcgattgcgagccaggcgatttgttcattcctgaagctgaagatcacaccgatttgctc
tcccgctgccaagcggcgatcgagcgcggtgccgcagccattctgaccgaacagctgctc
cctttggcgattccccaggcgattgttcccgacgcgcgggaagcgctcggaatcatctcg
cacgcgattgtcgggaatccctcggccaagatgcgcaccatcggcatcaccggctcgcac
ggcaaaacagccaccgccatgctcgtggcaagcgtgctcgaagcagccagccaagcgtgc
ggcgtgatttcgtcgctcggctatagcgactcgatcgagcaagtgagcaccaagtgcgcc
acaccacgttctcccaagctcgcgtggtggatgtcgcgcatggtgaaaaacaaagcagcc
gctgcggtcatcgaaatgtcgagccaaggcctttcgcagcgccgtacggccggcacttcg
ctcgatattgccgtgctgaccaacctccgcaacgtccacaccagcgagcatggctcggcg
gcaaattacctagcggccaagaagcggatcttctcgcatctcaagccgggtggattggcg
atcatcaacgccgacgatcaccgcagccgacagctgctcgaatcactcgcctgccccacg
ctcaccgtcggtttgcacgcggaagccgacatcagcgctcgtgtgatcgaccgctccatc
gccgagcaacgtttcacgatcaccgctggtgatgagacgattcaagtccgctcgcgcatc
atcggcgatgctcatgtggccaactgtttatcggctgtcgcggtgggactttcgctcggc
atcgaactctcgaccattgtgcgtggcatcgaaaatgtcacctacctgccgggtcgtatg
cagcggctcgaagtggggcaagagtttggcgtgatcgtcgatgccgccagcactcccgac
acgctggcgatcgctctgaagaccgcacggcgcgtgaccaaaggacgtgttttgctcgtg
ttttcggcctccggcgagaaaaatcgcgacgctcggccgatgctcgcgcgggtcgctgag
cagggagctgatctggcggtgatcaccagcggaaatccccgccgcgaatccccacgcgag
atcacgcatcagctgctcgacggttttcatcgacctgccaaagcccatttcattccgaca
cgtgcggaagcgattcgctgggcgcttggtcatgctcagccgggagactgcgtgctgatt
tgtggtcacggcgaccggacctcgcatctggtagggactcataaagtgcgtcacgacgat
cgcgaagtggcgctcacgtggctgtacgaaagtggtcagcgcgaactggccaaacctcag
ctgaaaatctttgggtag

DBGET integrated database retrieval system