KEGG   Pirellula staleyi: Psta_3910Help
Entry
Psta_3910         CDS       T01147                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
psl  Pirellula staleyi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Psta_3910
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psta_3910
Enzymes [BR:psl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Psta_3910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5085657..5087174
Genome map
AA seq 505 aa AA seqDB search
MPDAIIPTQNFRGISLRTVLSQVQFTKGQDIVCSAISTTEVDCEPGDLFIPEAEDHTDLL
SRCQAAIERGAAAILTEQLLPLAIPQAIVPDAREALGIISHAIVGNPSAKMRTIGITGSH
GKTATAMLVASVLEAASQACGVISSLGYSDSIEQVSTKCATPRSPKLAWWMSRMVKNKAA
AAVIEMSSQGLSQRRTAGTSLDIAVLTNLRNVHTSEHGSAANYLAAKKRIFSHLKPGGLA
IINADDHRSRQLLESLACPTLTVGLHAEADISARVIDRSIAEQRFTITAGDETIQVRSRI
IGDAHVANCLSAVAVGLSLGIELSTIVRGIENVTYLPGRMQRLEVGQEFGVIVDAASTPD
TLAIALKTARRVTKGRVLLVFSASGEKNRDARPMLARVAEQGADLAVITSGNPRRESPRE
ITHQLLDGFHRPAKAHFIPTRAEAIRWALGHAQPGDCVLICGHGDRTSHLVGTHKVRHDD
REVALTWLYESGQRELAKPQLKIFG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgctatcattccgacccagaatttccgtggtatttcgctccgaaccgtactt
tcacaagtgcagttcaccaaagggcaggacatcgtttgctccgctatttcgaccaccgaa
gtcgattgcgagccaggcgatttgttcattcctgaagctgaagatcacaccgatttgctc
tcccgctgccaagcggcgatcgagcgcggtgccgcagccattctgaccgaacagctgctc
cctttggcgattccccaggcgattgttcccgacgcgcgggaagcgctcggaatcatctcg
cacgcgattgtcgggaatccctcggccaagatgcgcaccatcggcatcaccggctcgcac
ggcaaaacagccaccgccatgctcgtggcaagcgtgctcgaagcagccagccaagcgtgc
ggcgtgatttcgtcgctcggctatagcgactcgatcgagcaagtgagcaccaagtgcgcc
acaccacgttctcccaagctcgcgtggtggatgtcgcgcatggtgaaaaacaaagcagcc
gctgcggtcatcgaaatgtcgagccaaggcctttcgcagcgccgtacggccggcacttcg
ctcgatattgccgtgctgaccaacctccgcaacgtccacaccagcgagcatggctcggcg
gcaaattacctagcggccaagaagcggatcttctcgcatctcaagccgggtggattggcg
atcatcaacgccgacgatcaccgcagccgacagctgctcgaatcactcgcctgccccacg
ctcaccgtcggtttgcacgcggaagccgacatcagcgctcgtgtgatcgaccgctccatc
gccgagcaacgtttcacgatcaccgctggtgatgagacgattcaagtccgctcgcgcatc
atcggcgatgctcatgtggccaactgtttatcggctgtcgcggtgggactttcgctcggc
atcgaactctcgaccattgtgcgtggcatcgaaaatgtcacctacctgccgggtcgtatg
cagcggctcgaagtggggcaagagtttggcgtgatcgtcgatgccgccagcactcccgac
acgctggcgatcgctctgaagaccgcacggcgcgtgaccaaaggacgtgttttgctcgtg
ttttcggcctccggcgagaaaaatcgcgacgctcggccgatgctcgcgcgggtcgctgag
cagggagctgatctggcggtgatcaccagcggaaatccccgccgcgaatccccacgcgag
atcacgcatcagctgctcgacggttttcatcgacctgccaaagcccatttcattccgaca
cgtgcggaagcgattcgctgggcgcttggtcatgctcagccgggagactgcgtgctgatt
tgtggtcacggcgaccggacctcgcatctggtagggactcataaagtgcgtcacgacgat
cgcgaagtggcgctcacgtggctgtacgaaagtggtcagcgcgaactggccaaacctcag
ctgaaaatctttgggtag

DBGET integrated database retrieval system