KEGG   Pirellula staleyi: Psta_3921Help
Entry
Psta_3921         CDS       T01147                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00972  
UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
psl  Pirellula staleyi
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psta_3921
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     Psta_3921
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     Psta_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5097167..5098663
Genome map
AA seq 498 aa AA seqDB search
MTSLAHSPRTWLPGPAHTLDRQTLALHLAPHGQEHLARFWDELSGTEKQQLGNQIDALDL
ALLAELREQGRQLLSSGVDSSAAQAQLFEALAARATAPPAMRLDGSGAIDRDQALAAGAD
LLTRGQVAMILVAGGLGSRLGFELPKGFYQLAPLSQRTLFDILISQLSSVERRYGQTIPL
YIMTSPATDALTREFLEKNNYFGKPRTSVRIFCQNVMWALDEQWNRLLMSSPSSLFLGPD
GHGGMLRALAESGCLADAEARGITQIFYGQIDNPLLQVCSELLLGSHVLAQSEMTTQVVE
KRHPLERVGNVVEVDGKVQVIEYVDLPESAARATSADGRLKLWAGNLAVHVFDTAFLARA
NRDQTSLPFHFARKKVPTIDDSGAVVEPTSINAIRFERFIFDLLPAARKSLVVEADPAEA
FAPVKNAEHEKTDTAATARAAMIAQARRWLEAAGAHVAPQVRVEIHPAFAATIDEVRARV
KPGTVIDRDTYFSPSGAL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcttgcccactctccgcgcacctggcttcccggcccagctcacacgctcgac
cggcagacgctggccctgcatttggcccctcatggtcaggagcatttggcaagattttgg
gacgaactaagcggcaccgagaagcagcaactcggaaaccaaatcgatgcgctcgatcta
gcgctcttggcggaactgcgcgagcaaggtcgacagctgctctcatcgggagtcgatagc
agcgcggcccaagcacagctgtttgaagcgcttgccgcgcgagccactgcgccaccggcg
atgcggctcgatggctcgggcgccatcgatcgcgatcaggcgctcgccgctggcgccgac
cttttgacgcgcggccaagtggcgatgattctcgtggcaggtggtcttggttcgcgactc
ggatttgaactccccaaaggattctatcagctcgctccgctgtcgcagcgcacactgttc
gacatcctgatttcgcagctttcaagtgtcgagcggcgctacgggcaaacgatcccgctc
tacatcatgacgagccccgccaccgacgcgctaacacgcgaatttctggagaaaaacaac
tattttggcaagcctcgcaccagcgtgcggatcttttgccaaaacgtgatgtgggccctc
gacgagcagtggaatcggctgctgatgtccagcccgagttcgctctttctcggccccgat
ggccacggcggcatgctgcgagccctcgccgaaagtggctgtctggccgatgccgaggcg
cgcggtattacgcaaattttctacggccagatcgataacccgctgctgcaagtttgcagc
gaactgctgctcggcagccacgtcctcgcgcaaagtgaaatgacgacgcaggtggtcgaa
aaacgtcatccgctcgagcgtgtggggaatgtggtcgaggtcgatggcaaagtgcaagtg
atcgagtatgtcgacttacccgagtcggcagcgcgtgccacgtcggccgatggtcgcctg
aaattatgggctggcaatttggccgtgcatgtcttcgacaccgccttcctggctcgagcc
aatcgcgatcaaacctcactaccgtttcactttgcccgcaaaaaagtcccgaccatcgac
gacagtggcgcggtggtcgaaccgacctcgatcaacgccattcgcttcgagcgatttatt
ttcgacctgcttcccgctgcccgtaaaagcctggttgtagaggctgatcccgccgaggca
tttgcgccggtgaagaacgccgagcacgaaaaaaccgacaccgccgccacggctcgcgcc
gccatgatcgcgcaagcgcgacgctggctcgaagctgctggggctcacgtcgcgccgcag
gtgcgtgtggaaattcatcccgcttttgctgcgacgatcgacgaagtccgtgcgcgtgtg
aagccgggcaccgttatcgatcgcgatacttacttttccccgtcaggagctctctga

DBGET integrated database retrieval system