KEGG   Pirellula staleyi: Psta_3921Help
Entry
Psta_3921         CDS       T01147                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00972  
UDP-N-acetylglucosamine pyrophosphorylase [EC:2.7.7.23]
Organism
psl  Pirellula staleyi
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:psl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5097167..5098663
Genome map
AA seq 498 aa AA seqDB search
MTSLAHSPRTWLPGPAHTLDRQTLALHLAPHGQEHLARFWDELSGTEKQQLGNQIDALDL
ALLAELREQGRQLLSSGVDSSAAQAQLFEALAARATAPPAMRLDGSGAIDRDQALAAGAD
LLTRGQVAMILVAGGLGSRLGFELPKGFYQLAPLSQRTLFDILISQLSSVERRYGQTIPL
YIMTSPATDALTREFLEKNNYFGKPRTSVRIFCQNVMWALDEQWNRLLMSSPSSLFLGPD
GHGGMLRALAESGCLADAEARGITQIFYGQIDNPLLQVCSELLLGSHVLAQSEMTTQVVE
KRHPLERVGNVVEVDGKVQVIEYVDLPESAARATSADGRLKLWAGNLAVHVFDTAFLARA
NRDQTSLPFHFARKKVPTIDDSGAVVEPTSINAIRFERFIFDLLPAARKSLVVEADPAEA
FAPVKNAEHEKTDTAATARAAMIAQARRWLEAAGAHVAPQVRVEIHPAFAATIDEVRARV
KPGTVIDRDTYFSPSGAL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcttgcccactctccgcgcacctggcttcccggcccagctcacacgctcgac
cggcagacgctggccctgcatttggcccctcatggtcaggagcatttggcaagattttgg
gacgaactaagcggcaccgagaagcagcaactcggaaaccaaatcgatgcgctcgatcta
gcgctcttggcggaactgcgcgagcaaggtcgacagctgctctcatcgggagtcgatagc
agcgcggcccaagcacagctgtttgaagcgcttgccgcgcgagccactgcgccaccggcg
atgcggctcgatggctcgggcgccatcgatcgcgatcaggcgctcgccgctggcgccgac
cttttgacgcgcggccaagtggcgatgattctcgtggcaggtggtcttggttcgcgactc
ggatttgaactccccaaaggattctatcagctcgctccgctgtcgcagcgcacactgttc
gacatcctgatttcgcagctttcaagtgtcgagcggcgctacgggcaaacgatcccgctc
tacatcatgacgagccccgccaccgacgcgctaacacgcgaatttctggagaaaaacaac
tattttggcaagcctcgcaccagcgtgcggatcttttgccaaaacgtgatgtgggccctc
gacgagcagtggaatcggctgctgatgtccagcccgagttcgctctttctcggccccgat
ggccacggcggcatgctgcgagccctcgccgaaagtggctgtctggccgatgccgaggcg
cgcggtattacgcaaattttctacggccagatcgataacccgctgctgcaagtttgcagc
gaactgctgctcggcagccacgtcctcgcgcaaagtgaaatgacgacgcaggtggtcgaa
aaacgtcatccgctcgagcgtgtggggaatgtggtcgaggtcgatggcaaagtgcaagtg
atcgagtatgtcgacttacccgagtcggcagcgcgtgccacgtcggccgatggtcgcctg
aaattatgggctggcaatttggccgtgcatgtcttcgacaccgccttcctggctcgagcc
aatcgcgatcaaacctcactaccgtttcactttgcccgcaaaaaagtcccgaccatcgac
gacagtggcgcggtggtcgaaccgacctcgatcaacgccattcgcttcgagcgatttatt
ttcgacctgcttcccgctgcccgtaaaagcctggttgtagaggctgatcccgccgaggca
tttgcgccggtgaagaacgccgagcacgaaaaaaccgacaccgccgccacggctcgcgcc
gccatgatcgcgcaagcgcgacgctggctcgaagctgctggggctcacgtcgcgccgcag
gtgcgtgtggaaattcatcccgcttttgctgcgacgatcgacgaagtccgtgcgcgtgtg
aagccgggcaccgttatcgatcgcgatacttacttttccccgtcaggagctctctga

DBGET integrated database retrieval system