KEGG   Pirellula staleyi: Psta_4326Help
Entry
Psta_4326         CDS       T01147                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psl  Pirellula staleyi
Pathway
psl00020  Citrate cycle (TCA cycle)
psl00640  Propanoate metabolism
psl00660  C5-Branched dibasic acid metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
psl01130  Biosynthesis of antibiotics
psl01200  Carbon metabolism
Module
psl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psta_4326
   00640 Propanoate metabolism
    Psta_4326
   00660 C5-Branched dibasic acid metabolism
    Psta_4326
Enzymes [BR:psl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Psta_4326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A NmrA
Motif
Other DBs
NCBI-ProteinID: ADB18973
UniProt: D2R511
Position
complement(5650091..5651281)
Genome map
AA seq 396 aa AA seqDB search
MKIHEYQGKELFRKAGVAVLRGKVARTPEEAAAAFTELGGPIAVVKAQIHAGGRGKGTTK
ENSAQRGVQLVKSAEEAATVARNLIGKTLVTIQTGEEGKVVNQVFVEEGCKIARELYLGI
VLDRAAAKPVLMVSTEGGVEIETVAHDTPEKIFKEHFDPHVGLLPYQVRKLCVLLGIKGA
SVASADKFMRALCKLWVQLDCAMVEINPLVITEAGDLVALDAKVAFDDNAMFRHKDLAEL
RDLTEEDPAEVRASNTGLSYVKLDGNIGCLVNGAGLAMSTMDIIKLHGGEPANFLDVGGG
ANEAQVTEAFRIILSDKNVKGILVNIFGGIARCTTIASAIVAASKAVGFNVPLVVRLEGT
EVEEGKKILRESGVKLIAADGLTDAAIKIVEAAKNA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggtaaagaactgtttcgtaaagctggcgtcgccgtgctg
cgaggcaaagtcgcccgcacgcccgaagaagcggctgcagcgttcacggaacttggcgga
ccgatcgccgtggtgaaagcacaaattcacgccggtggtcgcggtaagggaacgacgaaa
gaaaattctgcacagcgcggtgtgcaactcgtgaagtcggccgaagaagctgccacggtg
gcccgcaatctgattggcaagacgctggtgacgatccaaaccggcgaagaagggaaggtt
gtcaatcaggttttcgtcgaagaaggttgcaaaatcgctcgcgaattgtacctcggtatc
gtcctcgaccgagctgccgctaagccggtgctgatggtttcgaccgaaggtggcgtcgag
atcgaaacggtggctcacgacacccccgaaaagattttcaaagaacattttgatccccac
gtcggcctgcttccttatcaggtgcgcaagctgtgcgtgctgctcggcatcaagggagct
tcggtcgccagtgctgacaagttcatgcgagccctctgcaagttgtgggttcagctcgac
tgcgcgatggtcgaaatcaatccgctggtcatcaccgaagctggcgacctcgtcgcgctc
gacgctaaggtggccttcgacgacaacgccatgttccgccacaaggacctggccgaactg
cgcgatctcaccgaagaagatcctgctgaagtccgtgcctcgaacaccggtttgtcgtac
gtcaaactcgacggcaacatcggctgccttgtcaatggcgccggtctggcgatgtcgacg
atggacatcatcaaacttcatggtggcgagccagccaacttcctcgacgtcggtggtgga
gcgaacgaagctcaggtgaccgaagccttccgcattatcctttcggataagaacgtgaag
gggattctggtgaacattttcggcggtattgcccgctgcaccacgatcgccagcgccatt
gttgccgccagcaaagcagttggttttaacgtcccgctggtcgtgcgactggaaggtacg
gaagtcgaagaaggcaagaagatcttgcgtgaaagcggcgtgaagctgattgctgccgac
ggcctgaccgatgcggcgatcaagattgtcgaagcggcaaaaaacgcttag

DBGET integrated database retrieval system