KEGG   Pirellula staleyi: Psta_4385Help
Entry
Psta_4385         CDS       T01147                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psl  Pirellula staleyi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psta_4385
  Amino acid metabolism
   00340 Histidine metabolism
    Psta_4385
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Psta_4385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5718255..5719619
Genome map
AA seq 454 aa AA seqDB search
MPRMSEPFSIRVIDARQEPLAPALAELRERLSPRGNIVSEAGRKRTIDVFGKPLSPTEVV
ETICRDVRERGIAAVLDYSKKLDRADLTPETIRVSQAELDAAHAAADPAFLAAIARIQQN
ILEFQTAILHKEVEVRRNGVVLRQRYQPLERIGICVPGGAAAYPSTVLMTAVPAQAAGVS
QIVVIAPPTDFGANNRDVLATCKAIGVTEVYRMGGAQGVAALAYGVEGIPKVDKIVGPGN
LFVALAKRHVYGEVDIDSIAGPSEVVVISDETTRADFTAADLLAQAEHAPGASILITWSR
TALEATKRELERLVQTISRSELTLQSLRDFGCLILVDSPEEACRVTSEIAPEHLHIATEN
AGALLAKIRNAGATFLGNYSPVALGDYAAGPSHVLPTGGTARWASGLSANHFLRSSSVID
YSAEALRDIAPAIQMLADKEGLTAHRLSVDLRVE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgcatgtccgagccgttttcgattcgtgtgattgacgcccgccaagagcccctc
gccccagcgctggctgaacttcgcgagcgactgagcccgcgcggcaacatcgtcagcgaa
gctgggcgcaagcggacgatcgacgtctttggcaagccgctcagccccaccgaagtggtc
gagacgatctgccgcgacgttcgcgaacgcggcatcgccgcggtactcgactacagcaaa
aaactcgaccgggccgatctcacgccggaaacgattcgcgtctcgcaggccgagctcgac
gccgctcacgcagctgctgatccagcgtttctcgccgccatcgctcgcatccagcaaaac
atcctcgagttccaaacggcgattcttcacaaagaagtcgaggtccgccgcaacggcgtg
gtgctacggcaacgctatcagcctctggagcggatcggcatttgcgtccccggcggcgct
gctgcctatccatcgacggtcctgatgacagctgttccggcccaagctgctggcgtctct
caaattgtcgtcatcgctccgccgaccgattttggcgctaacaaccgcgatgtgcttgca
acgtgcaaagcgatcggcgtgaccgaggtctatcgcatgggtggcgcgcaaggtgtcgcg
gcactcgcctacggcgtcgaagggattcccaaggtcgataaaatcgtcggcccgggcaac
ttgttcgtcgcgctggcgaagcgacatgtctacggcgaagtcgatatcgattccatcgcc
ggacctagcgaagtagtcgtcatttccgacgaaacgacccgcgccgacttcaccgctgcc
gatcttctcgcgcaggccgaacatgcccccggcgccagcatcctgattacttggagccgc
accgcgctcgaagcgaccaagcgcgagctcgagcgactggtgcaaacgatttctcgcagc
gagctcaccctgcaatcgctccgcgattttggctgtttgattctcgtcgactcgccggaa
gaagcgtgccgcgtcaccagcgaaatcgcccccgagcacctgcatattgctaccgaaaat
gcgggcgcactactggccaagattcgcaacgccggagctacgttcctcggaaactacagc
cccgtcgccctcggcgattatgccgcgggaccttcgcacgtgctgccgacaggcggaacc
gctcgctgggcttcgggactttcggccaatcatttcctccgcagcagcagcgtgatcgac
tactccgcggaagccttgagagacatcgcccccgccatccaaatgctcgccgataaagaa
gggctcaccgcccatcgactgagcgtcgacctgcgtgtggagtaa

DBGET integrated database retrieval system