KEGG   Pirellula staleyi: Psta_4689Help
Entry
Psta_4689         CDS       T01147                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
psl  Pirellula staleyi
Pathway
psl00290  Valine, leucine and isoleucine biosynthesis
psl00770  Pantothenate and CoA biosynthesis
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01130  Biosynthesis of antibiotics
psl01210  2-Oxocarboxylic acid metabolism
psl01230  Biosynthesis of amino acids
Module
psl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
psl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Psta_4689
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Psta_4689
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Psta_4689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C F420_oxidored NAD_binding_2 AdoHcyase_NAD Nitro_FeMo-Co Mur_ligase DUF1103 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADB19331
UniProt: D2R800
Position
6100257..6101261
Genome map
AA seq 334 aa AA seqDB search
MAATIYYDNDADLSLLKNKTIAILGYGSQGHAQAQNLRDSGCNVIIGQRPGSPNYDLAVK
HGFKPMSAEEATKAADIINILLPDEVQGDVYRASIKPNLKPGNILMASHGFNMHFGQVEP
PAGVDAMLVAPKGPGHLVRSEFEKGGGVPGLIAIAPGSSADTIKYGLAYAKGIGATRGGV
IQTTIAEETETDLFGEQVVLCGGVSELVKAGFETLVEAGYQPEMAYFECMHELKLIVDLF
YQGGLNYMRYSVSNTAEYGDYTRGPRIVTEETKKEMKKILKEIQNGTFAREWILENKAGA
PGFKATRRNERGHQIEEVGRRLRKLMTWINAKEV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacgatctattacgacaatgatgccgatctctcgctgctgaagaacaagacc
attgccattctcggctacggttcgcaaggtcatgctcaggctcaaaacctgcgcgacagc
ggttgcaacgtcatcatcggccagcgccctggcagccctaactacgatcttgctgtgaag
cacggcttcaagccgatgagcgctgaagaagcgaccaaagcggctgacatcatcaacatc
ctgctccccgacgaagtgcaaggggacgtctatcgcgccagcatcaagccgaacctgaag
cccggcaacatcctgatggcttcgcacggtttcaacatgcacttcggccaggtcgagcca
cctgccggtgtcgatgcgatgctggtcgccccaaagggtcctggccacctcgttcgcagt
gaattcgaaaagggtggtggcgttcctggtctcatcgccattgctcccggcagcagcgcc
gacaccatcaagtacggtctggcctacgccaaggggatcggtgccacccgcggtggtgtg
atccaaaccacgattgctgaagaaaccgaaaccgacctgttcggcgagcaagtcgttctg
tgcggtggcgttagcgaactggtgaaggctggtttcgaaacgctcgtcgaagccggttat
cagccagaaatggcctacttcgaatgtatgcacgaactcaagctgatcgtcgacctgttc
tatcagggtggtctgaactacatgcgttacagcgtgtcgaacaccgctgaatacggcgac
tacactcgcggtcctcgtatcgtgaccgaagagaccaagaaggaaatgaagaagatcctc
aaggaaatccagaacggcacttttgcccgcgaatggatcctcgagaacaaggctggcgct
cctggcttcaaggccacccgtcgcaacgaacgtggtcaccagatcgaagaagtcggtcgc
cgcctccgcaagctcatgacttggattaacgccaaggaagtgtag

DBGET integrated database retrieval system