KEGG   Pirellula staleyi: Psta_4719Help
Entry
Psta_4719         CDS       T01147                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psl  Pirellula staleyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psta_4719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psta_4719
   00052 Galactose metabolism
    Psta_4719
   00500 Starch and sucrose metabolism
    Psta_4719
   00520 Amino sugar and nucleotide sugar metabolism
    Psta_4719
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psta_4719
   00524 Butirosin and neomycin biosynthesis
    Psta_4719
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psta_4719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6132700..6133728)
Genome map
AA seq 342 aa AA seqDB search
MYETVSLDKAQQPLFLGFDVGGTNLKLGIVDDRGRVLARGSIPTNESAGPADAVRRAHSF
VSEMLAKLGLKISDLAAVGLGTPGTLDIKAGRILEPHNLPHWFHFPIRECVSLAFGLPVS
FANDANAAAYGEFWVGSGKAFHSMILLTLGTGVGGGIIIGDMSIDGENSHGSECGHIIID
CNPTARVCPCGQPGHLEGYCSATALVRRASELLSTGRDTSIRVRLDADEELSALLIAQEA
EKGDLFSIELIDELAHYLAVGITSLMHTIDPGAVVLGGAMNFGGHQSPLGRRFLGSIRAG
VTQYAFRIPAQRTTIDFAMLGGDAGFIGAAGIARVDHHKKRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagaccgtttcgctcgacaaagcacaacagcccctcttcctcggatttgatgtc
ggagggaccaaccttaagcttggtatcgtcgacgatcggggacgcgttctggcccgggga
tcgattccgaccaacgaatcggcaggaccagccgacgctgttcgccgggcgcactcgttt
gtgtccgaaatgcttgccaaattgggacttaagatctcggatttggcggccgttggactc
ggaacaccgggaacgctcgatattaaagcagggcgaatcctcgagccccataatctgccg
cactggttccattttccgattcgcgaatgtgtttcgcttgccttcggactgccggtcagc
tttgccaacgacgccaacgccgccgcgtatggcgagttttgggtcggcagtggtaaagcc
tttcatagcatgatcttactgaccctaggaacgggcgttggtgggggcattatcatcggc
gatatgtcgatcgatggcgaaaacagccacggcagcgaatgcgggcatatcatcatcgac
tgtaaccccacggcgcgagtttgcccctgtggtcagccggggcatttagaagggtactgt
agcgccacggccctggtgcgtcgtgcgtcggaacttctttccacggggagagatacgtcg
attcgtgtgcgactggatgccgatgaagaactctcggccctgctcattgcccaggaggcg
gagaagggggatctgttttccattgagctgatcgatgagctagcccattatctcgcagtg
ggaatcaccagcttgatgcacaccatcgatcccggggcggtggtgctcggcggggcaatg
aattttgggggacatcagtctcccttggggcgacgctttctgggctcgattcgggctggc
gtgacgcagtacgcctttcgcattcctgcccagcggactacgatcgattttgcgatgctc
gggggagatgccggatttatcggcgccgccgggatcgcccgcgtcgaccatcacaaaaag
cgaggctga

DBGET integrated database retrieval system