KEGG   Pseudoalteromonas sp. SM9913: PSM_A0074Help
Entry
PSM_A0074         CDS       T01374                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(75921..76475)
Genome map
AA seq 184 aa AA seqDB search
MHNELKESYQKIITAVGEDAEREGLLDTPKRAAKAMEYLTQGYRQTLNEITNNAVFTSDA
DDMVLIQDIELYSMCEHHLLPFIGRCHIAYIPDGKVLGLSKFARIVDMFSRRFQIQEQLT
HQIAKAVEEVTGAKGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRADPKTRNEFLQ
LIKG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgaattaaaagaaagctatcaaaaaattataactgctgtaggtgaagacgct
gaacgtgaagggttacttgataccccaaaacgcgctgcaaaagcgatggagtaccttact
caaggatatcgtcaaacgcttaacgaaatcactaacaatgcggtattcacctctgacgct
gacgacatggtattgatacaagacatcgagctttactctatgtgtgaacatcatttactc
ccttttattggccgctgtcatattgcttatatccctgatggcaaagtattaggcttatct
aagtttgcgcgtattgttgatatgttttcgcgtcgttttcaaattcaagaacagcttacc
catcaaattgcaaaagcggttgaggaagtaaccggtgcaaaaggtgtgggggtaattgtt
gaagcaaaacacatgtgtatgatgatgcgtggtgtagaaaagcaaaactcaagcatgcgt
acctcggtaatgctaggaaactttagagccgatccgaaaacacgtaatgagtttttacag
ctgatcaaaggataa

DBGET integrated database retrieval system