KEGG   Pseudoalteromonas sp. SM9913: PSM_A0104Help
Entry
PSM_A0104         CDS       T01374                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSM_A0104
Enzymes [BR:psm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PSM_A0104
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSM_A0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:102489..104330
Genome map
AA seq 613 aa AA seqDB search
MKHILITRPEGKGAALAQQLEQAGYQASLCPVLKITYLTPTSVELSPLVNADKIIFVSQD
AVHALSALKPAINTKAQFYGVGQQTADTIYEVFGVRAALPKQHDSEGLLALKSLAEVDGS
NIVLVKGIGGRPEIAKTLKQRGAFLNNCVVYQREPVAQQSADWIDHWQSQNVHGIVITSN
AAVDAIFNTLTAAQLTWLQQCEFYVASERIGDYLQQQKINSTHIHTAAGASDHAMFACIN
QQGSKMSEQSATSKVEKAAAQPIANNTSNTAKNDTAKANNQTQNNTHKVSKVGSLALVIS
LLVASGVGYEFYQKLNAGKVQNLAVNALSEQNKILQQELQALKSEQLSLQQALQKSEEQT
AMALNENSVKNQQALKAALQKVQQSGNTLNPQEVTSLQRMAEFKLWAEQDYQGTSAVLKR
LDSLLSDHPGTLELRQAIIQDIQTLDSIKPVATEAIYLQLNSVRDRIDNLVFNAVNLPEE
ASVTDENALSENMSDWQQNIRNSWNKIVDSFITIRHHEGVLIEPLLTDRERHLINQRIKL
NITQAQDALMSKQASIYFSALNDTKRLVTEYFKQDDNATKVVLQTLVNLEKEPLNFNPEV
TLQSTQQVKEWAQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatcttgataactcggcccgaaggaaaaggcgcagcccttgcacagcaactt
gagcaagcgggttatcaagcgtctttatgtcctgttctaaaaataacgtatttaacccca
accagcgttgagctaagcccgttggttaatgccgacaaaattatttttgtttcgcaagat
gcagtacatgcactgagtgcgcttaagcctgcaattaacaccaaagcgcagttttatggt
gttggccaacaaactgccgacaccatttatgaagtatttggtgtacgtgctgctttgcca
aaacaacatgattctgaggggttgctggcgcttaagtcattggctgaggttgatggcagt
aatatcgtgttggttaaaggcattggtgggcggcctgagatagcaaaaaccttaaaacaa
cgcggtgcttttttaaataattgtgtggtgtatcagcgcgagccggtagcgcaacaatcc
gctgactggatagaccactggcaaagccagaatgtacacggtatagtcattactagtaat
gccgccgttgatgccatttttaatacccttaccgcggcgcaactaacatggttacaacag
tgcgaattttatgttgccagtgagcgtattggcgattatttacaacagcaaaaaataaat
tcgacacatatacatactgcggcaggggctagcgaccacgctatgtttgcctgcattaat
cagcaaggtagcaaaatgagtgaacagtcagcgacgtcaaaagtagaaaaagcagcagcg
caaccaatagccaataacacgtctaataccgctaaaaacgacactgcaaaagccaataat
caaacgcaaaataatacccataaagtgagtaaggtggggagtttagcgttggtgatttcg
ttacttgttgccagtggcgtgggttatgagttttatcaaaagctcaatgccggtaaagtg
caaaatttagcggttaatgcattatcagagcaaaataagatattgcagcaagagctgcaa
gcgcttaagtctgagcaactcagtcttcagcaagcgttacaaaagagcgaagagcaaact
gctatggcgcttaatgaaaactctgtaaaaaatcagcaagcattaaaagcagcactgcaa
aaagtgcagcaaagtggtaacacattaaacccacaagaagtgaccagcttacaacgcatg
gctgaatttaaattgtgggctgaacaagattatcaaggcacaagtgcagtgcttaaacgt
ttagattcacttttaagcgaccacccaggcacgcttgaattgcgccaagcaattatacaa
gacatacaaacgctcgatagcattaaacccgttgcgacagaggcgatttacttacagtta
aatagtgttagagatcgtatcgataacttggtatttaatgcggttaatttgccagaagaa
gcgtcagtaactgacgaaaacgcgctctctgaaaatatgagtgattggcagcaaaatatc
cgaaatagctggaataaaatagttgatagctttattacaattcgccatcacgaaggggta
ttaatagagccgctattaactgatagagagcgccacctgattaatcagcgcataaagctc
aatattactcaggcgcaagatgcactaatgagcaagcaagccagcatctattttagcgcc
ttaaacgacacaaaacgtttagttactgaatactttaagcaagatgataatgccacaaaa
gtggtactacaaactttagtaaaccttgaaaaagagccgcttaactttaaccctgaggtg
acattgcaaagtactcagcaagttaaggagtgggcacaatga

DBGET integrated database retrieval system