KEGG   Pseudoalteromonas sp. SM9913: PSM_A0133Help
Entry
PSM_A0133         CDS       T01374                                 

Definition
carbohydrate phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:145925..146722
Genome map
AA seq 265 aa AA seqDB search
MDKLLEPCITLAQSAGDAIMAIYKKDDIGQQEKSDNTPVTKADLAANDVLVAGLKALAPD
IPIMSEETPIPALEDRQHWQRYWLLDPMDGTGEFILESGDFAVNIALIENNHPVLGVIHW
PAKDVTYFATANNGAFKRKGEHDKQIFVAPPESLTLAVSRRQKIEAVSQYLNAQFATVAL
GSCSLKACIVAEGKADCFLRIGPTGEWDTGASQVIVEEAGGCITDAEFNPLTYNQRESTE
NPDFIVMGHPDWEWQKMINPHQRLV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggataaattacttgaaccatgcataacacttgcccaaagtgcaggtgatgcaattatg
gctatttataaaaaagatgatattggtcaacaagaaaaatcagacaatacgccagttact
aaagcagatttagccgcaaacgatgtacttgttgctggcttaaaagcgctagctcccgat
attcctattatgtccgaagagacgccgatcccagcattggaagacaggcagcactggcaa
cgctattggctgcttgatccgatggatggcaccggtgaatttatattagaaagcggcgac
tttgccgttaatattgcgctgatagaaaataatcatcctgtattgggagtgattcattgg
ccagcaaaagacgtgacctattttgctaccgctaataatggggcgtttaagcgtaaaggc
gagcatgataaacaaatatttgtagcgcctcccgaaagtttaactttggctgtaagtcgc
cgccaaaaaatagaagccgtgagtcagtatttaaatgcgcaatttgcaacggtggcttta
ggctcatgttcgcttaaagcttgtattgttgctgaagggaaagctgactgctttttaaga
attggtcccactggtgaatgggacactggcgcatcacaagtaatagttgaagaggctggg
gggtgtattaccgatgctgagtttaaccctctgacctataaccaaagggaaagcacagaa
aacccagactttattgttatggggcatcccgattgggagtggcaaaaaatgataaaccca
catcagcgattagtgtaa

DBGET integrated database retrieval system