KEGG   Pseudoalteromonas sp. SM9913: PSM_A0133Help
Entry
PSM_A0133         CDS       T01374                                 

Definition
carbohydrate phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSM_A0133
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PSM_A0133
Transfer RNA biogenesis [BR:psm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PSM_A0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:145925..146722
Genome map
AA seq 265 aa AA seqDB search
MDKLLEPCITLAQSAGDAIMAIYKKDDIGQQEKSDNTPVTKADLAANDVLVAGLKALAPD
IPIMSEETPIPALEDRQHWQRYWLLDPMDGTGEFILESGDFAVNIALIENNHPVLGVIHW
PAKDVTYFATANNGAFKRKGEHDKQIFVAPPESLTLAVSRRQKIEAVSQYLNAQFATVAL
GSCSLKACIVAEGKADCFLRIGPTGEWDTGASQVIVEEAGGCITDAEFNPLTYNQRESTE
NPDFIVMGHPDWEWQKMINPHQRLV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggataaattacttgaaccatgcataacacttgcccaaagtgcaggtgatgcaattatg
gctatttataaaaaagatgatattggtcaacaagaaaaatcagacaatacgccagttact
aaagcagatttagccgcaaacgatgtacttgttgctggcttaaaagcgctagctcccgat
attcctattatgtccgaagagacgccgatcccagcattggaagacaggcagcactggcaa
cgctattggctgcttgatccgatggatggcaccggtgaatttatattagaaagcggcgac
tttgccgttaatattgcgctgatagaaaataatcatcctgtattgggagtgattcattgg
ccagcaaaagacgtgacctattttgctaccgctaataatggggcgtttaagcgtaaaggc
gagcatgataaacaaatatttgtagcgcctcccgaaagtttaactttggctgtaagtcgc
cgccaaaaaatagaagccgtgagtcagtatttaaatgcgcaatttgcaacggtggcttta
ggctcatgttcgcttaaagcttgtattgttgctgaagggaaagctgactgctttttaaga
attggtcccactggtgaatgggacactggcgcatcacaagtaatagttgaagaggctggg
gggtgtattaccgatgctgagtttaaccctctgacctataaccaaagggaaagcacagaa
aacccagactttattgttatggggcatcccgattgggagtggcaaaaaatgataaaccca
catcagcgattagtgtaa

DBGET integrated database retrieval system