KEGG   Pseudoalteromonas sp. SM9913: PSM_A0193Help
Entry
PSM_A0193         CDS       T01374                                 

Gene name
pldA
Definition
phospholipase A precursor (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PSM_A0193 (pldA)
   00565 Ether lipid metabolism
    PSM_A0193 (pldA)
   00590 Arachidonic acid metabolism
    PSM_A0193 (pldA)
   00591 Linoleic acid metabolism
    PSM_A0193 (pldA)
   00592 alpha-Linolenic acid metabolism
    PSM_A0193 (pldA)
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PSM_A0193 (pldA)
    3.1.1.32  phospholipase A1
     PSM_A0193 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(203823..204854)
Genome map
AA seq 343 aa AA seqDB search
MSWRHWILLSTLLSTTVVAEETANNEQNNELELVKQCILNEVIGGDGKQTLDQLRKKCSA
VEESKQLTAIDKRQAREAVGKKNRNVITPHKRNYILPVSYMSNPNTRPFDGFAELTDKKD
GDPLDNLEAKYQLSIKVPLYDEFTDSDQAIFFGFTLQSYWQVYNDDISSPFRETNYEPEV
FWINYLDPENVLWGDEMAIAIGISHQSNGRSQPNSRSWNRIYADFIWEKDGFVFSFKPWY
RIPENKKPAPLDARGDDNPDIYKYMGYFEFGGAYRFNDHEFSFMTRNNLNSDNRGAIQLD
WSFPLWGRVRGYAQYFNGYGESLIDYNTDIERFGVGILLTDLL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcgccattggatactactttctacattacttagcacaaccgttgttgctgaa
gaaacagcgaataacgagcaaaacaatgaacttgagctggttaaacaatgtattttaaat
gaagtgatcggtggagacggtaaacaaacgctcgatcaattacgtaaaaagtgttctgcc
gttgaagaaagcaagcagctaacggctatcgacaaacgccaagcccgtgaagcggttggt
aaaaaaaatcgtaatgtaattaccccgcataaacgtaattatattttacctgtttcttat
atgtcgaacccaaacactcgcccgtttgatggatttgcagagttaaccgataaaaaagat
ggcgacccacttgataacctagaagctaaatatcagctatcaattaaagtgcctttgtat
gatgagtttactgactcagaccaggcgatattttttggctttactttgcagtcatactgg
caagtatataacgacgatatttcttccccttttcgtgaaaccaactacgagccagaagta
ttttggattaattacttagaccctgaaaacgttttatggggcgatgaaatggcaatagcc
attggtatttcgcaccaatctaatggtcgtagtcagccaaactcgcgttcttggaatcgc
atttatgccgatttcatttgggaaaaagacggctttgtatttagctttaaaccttggtat
cgcattcctgaaaacaaaaagcctgcgccgttagatgcacgaggtgacgataacccagat
atctataaatacatgggttactttgaatttggtggcgcgtatcgctttaacgatcatgaa
tttagttttatgactcgcaataatttaaattcagataaccgcggggcaattcagcttgat
tggtcattcccattatggggaagagttcgcggctacgcacaatattttaatggctatggc
gagagcttgatagactataacaccgatatcgaacgctttggtgtgggtatattactgaca
gatttactgtaa

DBGET integrated database retrieval system