KEGG   Pseudoalteromonas sp. SM9913: PSM_A0221Help
Entry
PSM_A0221         CDS       T01374                                 

Gene name
cysQ
Definition
3',5' adenosine diphosphate 3' phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(233917..234624)
Genome map
AA seq 235 aa AA seqDB search
MGIYNKDFNVEYKADESPVTDADLAAHKIISAGLKELTPDIPVLSEESADIGWDVRQTWK
SYWLVDPIDGTKEFIKKNGEFTVNIALIENGKPVLAVVDAPALGVSYLAAEAIGAFKDKG
DERIELKVTTKPNKGIIRVVGSRSHPSPDLAEFVQRFDEVEMVLKGSSLKLCLVAEGSAD
IYPRLGPTCEWDTGAGHAIAEIAGAKVTQLDGSPLLYNTKDEYLNPYFVVSALEE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacaataaagactttaacgttgagtacaaagccgatgaaagccctgtaacc
gacgccgacttagcagctcataaaatcattagcgcaggactaaaagagctcacccccgat
attcctgtgcttagtgaagaaagtgccgatattggttgggatgtacgccaaacatggaaa
agctactggctggttgacccaatcgatggcaccaaagaatttataaaaaagaacggcgag
tttaccgttaatattgccctaatcgaaaatggcaaaccggttttagccgtggttgatgcc
cctgcactgggtgtatcttatttagccgccgaagccattggtgcttttaaagataaaggc
gatgagcgcatcgagcttaaagtgaccaccaagcctaacaaaggcattattcgtgttgta
ggtagccgctcgcatccttcccctgatttagctgaatttgtacaacgctttgatgaggtt
gaaatggtgttaaaaggcagctcactgaaactgtgtttagtcgccgaaggcagcgccgac
atatatccgcgcttaggcccaacttgtgaatgggataccggcgcaggccacgccatcgct
gaaatagccggcgctaaagtcactcaacttgatggtagcccgcttttgtacaacaccaaa
gatgagtatttgaatccgtattttgtggtttcggcactcgaagaataa

DBGET integrated database retrieval system