KEGG   Pseudoalteromonas sp. SM9913: PSM_A0461Help
Entry
PSM_A0461         CDS       T01374                                 

Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSM_A0461
   00052 Galactose metabolism
    PSM_A0461
   00500 Starch and sucrose metabolism
    PSM_A0461
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A0461
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSM_A0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:492007..492897
Genome map
AA seq 296 aa AA seqDB search
MKAVIPVAGLGTRMLPMTKAIPKEMLPLVDKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELEATLEKRVKRTLLDEVRSICPADVTIMHVRQGEAKGLGHAILCAKPIVGD
SDFVVVLPDVILDAYTADQKTENLAAMIARFKQTHASQIMLEPVAIEDVSKYGIADINGV
ELAAGESAAIKKMVEKPAADVAPSNLAVVGRYVLSKNIWPLLAKTHVGAGGEIQLTDAID
ALLAIDTVEAFHMSGRSHDCGDKLGYLKAIVEYSMRDKSLGDEFTEYMKELVTGIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgtaattcctgttgccggtttaggcacccgtatgttgccaatgactaaggca
atccctaaagaaatgctccccttggttgataaaccgctgattcaatacatagtaaatgaa
tgtgtggcggcgggtattaaagaaattgtgctcgtaacacatagctctaaaaatgccatt
gaaaaccattttgataccagttttgagttagaagccacgctagaaaaacgtgtaaaacgt
actttgctagatgaggtgcgctctatttgcccagcagatgttactattatgcacgttcgc
caaggtgaagctaaaggcttagggcacgctattttatgtgccaagccaatagttggtgat
agtgactttgttgtggttttacccgatgtaattttagatgcttatacggcagatcaaaaa
actgaaaacttagcggcgatgatcgcacgctttaagcaaacccatgccagccaaattatg
ttagagcccgttgctattgaagatgtaagtaagtacggcattgctgatattaatggtgta
gagcttgctgctggtgaaagtgcagcaattaaaaaaatggttgaaaaaccagccgcagat
gttgctccttcaaatttagctgttgttggtcgttatgttttaagtaaaaatatttggcca
ttactcgctaaaactcatgtaggcgcaggcggtgaaatacagcttacagacgcgattgat
gcattattggctattgatacggtagaagcgtttcatatgagtggccgctcacacgactgt
ggcgataaactcggttatttaaaagcgattgtagaatacagcatgcgcgataaaagctta
ggcgatgagtttactgaatatatgaaagagttggtaacgggcatcgggtaa

DBGET integrated database retrieval system