KEGG   Pseudoalteromonas sp. SM9913: PSM_A0461Help
Entry
PSM_A0461         CDS       T01374                                 

Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00040  Pentose and glucuronate interconversions
psm00052  Galactose metabolism
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm01100  Metabolic pathways
psm01130  Biosynthesis of antibiotics
Module
psm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSM_A0461
   00052 Galactose metabolism
    PSM_A0461
   00500 Starch and sucrose metabolism
    PSM_A0461
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A0461
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSM_A0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADT67414
Position
I:492007..492897
Genome map
AA seq 296 aa AA seqDB search
MKAVIPVAGLGTRMLPMTKAIPKEMLPLVDKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELEATLEKRVKRTLLDEVRSICPADVTIMHVRQGEAKGLGHAILCAKPIVGD
SDFVVVLPDVILDAYTADQKTENLAAMIARFKQTHASQIMLEPVAIEDVSKYGIADINGV
ELAAGESAAIKKMVEKPAADVAPSNLAVVGRYVLSKNIWPLLAKTHVGAGGEIQLTDAID
ALLAIDTVEAFHMSGRSHDCGDKLGYLKAIVEYSMRDKSLGDEFTEYMKELVTGIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgtaattcctgttgccggtttaggcacccgtatgttgccaatgactaaggca
atccctaaagaaatgctccccttggttgataaaccgctgattcaatacatagtaaatgaa
tgtgtggcggcgggtattaaagaaattgtgctcgtaacacatagctctaaaaatgccatt
gaaaaccattttgataccagttttgagttagaagccacgctagaaaaacgtgtaaaacgt
actttgctagatgaggtgcgctctatttgcccagcagatgttactattatgcacgttcgc
caaggtgaagctaaaggcttagggcacgctattttatgtgccaagccaatagttggtgat
agtgactttgttgtggttttacccgatgtaattttagatgcttatacggcagatcaaaaa
actgaaaacttagcggcgatgatcgcacgctttaagcaaacccatgccagccaaattatg
ttagagcccgttgctattgaagatgtaagtaagtacggcattgctgatattaatggtgta
gagcttgctgctggtgaaagtgcagcaattaaaaaaatggttgaaaaaccagccgcagat
gttgctccttcaaatttagctgttgttggtcgttatgttttaagtaaaaatatttggcca
ttactcgctaaaactcatgtaggcgcaggcggtgaaatacagcttacagacgcgattgat
gcattattggctattgatacggtagaagcgtttcatatgagtggccgctcacacgactgt
ggcgataaactcggttatttaaaagcgattgtagaatacagcatgcgcgataaaagctta
ggcgatgagtttactgaatatatgaaagagttggtaacgggcatcgggtaa

DBGET integrated database retrieval system