KEGG   Pseudoalteromonas sp. SM9913: PSM_A0497Help
Entry
PSM_A0497         CDS       T01374                                 

Gene name
murF
Definition
D-alanine:D-alanine-adding enzyme (EC:6.3.2.10)
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:526939..528327
Genome map
AA seq 462 aa AA seqDB search
MIPMDFDWLANVLATDYQGDNRKVININTDTRTLCDGEVFLALKGPNFDGHKFIEQAKQK
GAIGVIVDHAVDTDIAQFVVADTRIALGTIGTAVMAQVAPKTIAITGSVGKTTVKEMCAA
ILSSKGDVLATKGNFNNDIGVPLTLLRLEPQHRFAVIELGANHIGEIAYTTAMTKPDVAV
VCNVAAAHLEGFGSLQGVAQAKGEIYDGLKEDGIAIVNCDSDFSQYWLDKLATRNIKCFS
SSEKLDIWAEDISLDAQARASFTLCTKQHSVPVKLALPGKHNISNALIAAALTSEFDVSL
EDIASALATMGEVKGRVNLIEASDSLTIIDDTYNANVKSVKAAIDLLSDIQGHRILALGD
MGELGEDARKYHQEVGEYALAQGIDELFTLGVLSKCASDVFGLPNRHFSNREQMLQQIQN
SISKVDKKITLVVKGSRSSRMELLVTDLVNGQQQAINGVSSC
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgatggattttgattggctagctaatgtgctagcaaccgattatcaaggtgat
aatcgcaaggtgataaatataaacaccgatacccgtactttatgtgatggtgaagtgttt
ttggcgcttaagggcccaaattttgatggccataaatttattgaacaagcaaaacaaaaa
ggcgctataggcgtgattgtcgatcacgctgttgataccgatattgctcaatttgtagtt
gccgatacccgtattgcattaggcacaattggtacagcagtgatggcgcaagttgcacct
aaaactatcgctattactggcagtgtaggtaaaaccacagttaaagaaatgtgtgccgct
attttatcaagtaaaggggatgtattagccactaaaggtaattttaacaacgacattggc
gtaccgttaactttactcagattagagccacaacatcgctttgcggttattgaattaggc
gctaaccacataggtgaaattgcgtacaccaccgcgatgaccaaaccggatgtagctgtg
gtatgtaatgttgctgctgcccacttagaaggctttggtagcctgcaaggtgtggcacaa
gcaaaaggtgaaatttacgacggattaaaagaggatggcatcgccatcgtcaattgcgat
agtgactttagtcaatattggcttgataagttagcaacgcgcaatattaaatgtttttcg
agtagtgaaaagctcgatatttgggctgaggacatcagcctagatgcacaagctcgcgca
agctttactttgtgcaccaagcaacacagtgtgccggttaagttagcactgccaggtaaa
cataatattagtaacgcgcttattgctgcggcgttaaccagtgagtttgacgtgtcactt
gaggacattgccagcgcgttagcgaccatgggtgaagttaaaggacgggttaacctaatt
gaagccagtgattcactcaccattatcgatgatacatacaatgccaacgtaaagtcggtg
aaagctgcgattgatttacttagtgatattcaaggtcatcgtattttggcactcggtgat
atgggtgaacttggcgaagatgcccgtaaatatcatcaagaagtcggtgaatacgcatta
gcgcaaggcattgatgagttatttacactcggagtattaagtaaatgtgccagtgatgta
tttgggctgccaaatcgccatttctctaatcgtgagcaaatgctgcagcaaattcaaaac
agcattagcaaagtagataaaaaaattacccttgtcgtgaaaggatcacgcagttctcgc
atggagcttttagtaaccgatttagttaatggccagcaacaagccatcaatggagtatca
tcatgttag

DBGET integrated database retrieval system