KEGG   Pseudoalteromonas sp. SM9913: PSM_A0522Help
Entry
PSM_A0522         CDS       T01374                                 

Definition
glutathione peroxidase precursor (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSM_A0522
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSM_A0522
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSM_A0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(550345..550914)
Genome map
AA seq 189 aa AA seqDB search
MIKKIILGLTLALSCVSLNTYAADSPPPSLDANTCNDFTNVSLRKLRSTETINLCDFKNQ
PLLIVNTASNCGFTPQFEGLEALYNKYKDEGLVVLGFPSDDFFQEENDEKDTAKVCYVNY
GVTFPMLATSAVRGSDANPIFKHLNAQTSSPNWNFYKYVVSADRKTITRFNSRVAPDSAK
LESAIKSAF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaataatacttggtttaaccctcgcgttaagttgtgtttcgctaaataca
tatgccgcagactcgccccccccttcattagatgcaaacacctgcaatgacttcacgaat
gtttcacttagaaagttgcgctcaactgaaaccattaacttatgtgattttaagaaccag
cctcttttaattgttaacactgcgagtaactgcggttttacgccgcaatttgaaggttta
gaagcactttataataaatacaaagacgaaggcttggtggtattaggctttccatcagat
gatttttttcaagaagagaacgatgaaaaagataccgcaaaagtgtgttatgtaaattat
ggtgttaccttccctatgctggccaccagcgcagtacgtggtagtgacgcaaaccctatt
tttaagcatttaaacgcccaaaccagttcaccaaactggaacttttataaatacgtggta
tcggccgatcgcaaaacgattacgcgctttaacagccgcgtagcaccggattcagcaaaa
ctagaaagcgcaatcaaaagtgcattttaa

DBGET integrated database retrieval system