KEGG   Pseudoalteromonas sp. SM9913: PSM_A0633Help
Entry
PSM_A0633         CDS       T01374                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:psm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:psm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:psm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:psm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(673942..674388)
Genome map
AA seq 148 aa AA seqDB search
MNMNAQFFILKQQDESLAKADDHFALAAQIAGQQYRLGQRVFIFVDSEETANSIDETIWT
FDADSFVPHNLQGEGPKGGAPVEIGTTPPVGNRKVLINLANHLPDFIRRFNQVFDFVPVE
PVAKQAARERFKKLRQLGANITTQDINR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaatgcccagtttttcattttaaagcaacaagatgagtcattagctaaagcc
gatgatcactttgctttagcagctcaaatagctgggcaacagtatcggcttggtcaacgc
gtatttatttttgtagatagcgaagaaaccgccaacagcattgacgaaactatttggaca
tttgatgccgacagttttgtacctcacaatttacaaggcgaaggcccaaaaggcggcgca
cctgtagaaataggcacaacaccacccgttggtaatcgtaaagtattaattaacttggcc
aatcacttaccggattttattcgtcggtttaaccaagtttttgattttgtacccgtagag
cccgtagccaaacaagccgctcgtgagcgctttaaaaaactacgccaactcggtgccaat
atcaccacgcaagatattaatcgctaa

DBGET integrated database retrieval system