KEGG   Pseudoalteromonas sp. SM9913: PSM_A0699Help
Entry
PSM_A0699         CDS       T01374                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSM_A0699 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSM_A0699 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSM_A0699 (thrC)
Enzymes [BR:psm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSM_A0699 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:751293..752576
Genome map
AA seq 427 aa AA seqDB search
MQLHNLKEYSQKVSFVEAVKTGLGRNQGVFFPESLAPLSDVDALLDMDFVTRSGKILSHL
IGDELPSDTVAQMVKNAFNFPVKLVEVEDNTYCLELFHGPTLAFKDFGGRFMAECLAQFN
QGEKVTILTATSGDTGAAVAHAFYNKPNIDVVILYPKGKISLAQQKLFTTLGDNIHCYAI
EGSFDDCQELVKKSFLDEELKSKLGLNSANSINISRLVAQVCYYFEAIAQLPKEKRATAH
ISVPSGNFGNVCAAMIGAVIGMPVGKLSATTNQNDTVPRFMLDKNWTPNATIESLSNAMD
VSKPNNWPRVQSMLDNNWFSYDNFYSVSVDEQQTQTVMKKIQQLGYIAEPHTAIAYQGLV
ENKAADAVGIFLATAHPAKFKDSVEDILNVELDMPKPLADALAKPCLATDMHNDYDILRT
ELFKKLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacataatttaaaagaatattcacaaaaagtgtcgtttgttgaagctgtaaaa
acaggactagggcgtaatcaaggtgtgttttttccagagtcgttagcgccattaagtgat
gttgatgcattactagatatggactttgttactcgcagcggcaaaattttatcgcacctt
attggtgacgagctaccaagtgatactgttgcccagatggttaagaatgcgtttaacttt
ccggttaagctggtggaagttgaagataatacctattgcttagagttatttcacgggcca
acactggcatttaaagattttggtggccgttttatggccgagtgcttggcgcaatttaat
caaggtgaaaaagtcactattttaactgcaacatcgggtgataccggggctgccgtagcg
catgctttttataacaaaccaaatattgatgtcgttattttataccctaaaggtaaaatt
tcattagcgcagcaaaagttatttacaacgcttggtgacaacattcactgttatgcgatt
gagggtagttttgatgattgccaagaattggttaaaaaatcatttttagatgaagagcta
aaatcgaagttaggtttaaactcagcaaattcaattaacattagccgtttagtcgcgcag
gtgtgttattactttgaagccattgcacagctgccaaaagaaaagcgtgctacagcgcat
atttcagtaccgagtggtaactttggtaatgtgtgtgcggctatgattggcgcggttatt
ggtatgccagttggtaaactaagtgcgactacaaaccaaaacgacacagtaccgcgcttt
atgcttgataaaaattggacgcctaatgcgacaattgaatcgctttcaaatgcaatggat
gtgagtaaacctaataactggccacgtgtgcaatcaatgttagataataactggtttagt
tatgataacttttattcggtgagtgttgatgagcagcaaacacaaacagtgatgaaaaaa
attcaacagcttggctatattgcagagcctcacaccgcaattgcttaccaaggtcttgta
gaaaataaggcagcagatgctgtggggatttttttagcgactgcgcatccggccaaattt
aaagacagcgttgaggatatccttaatgttgaattagatatgccaaagccgttagctgat
gcattagcaaaaccgtgtttagccactgatatgcacaacgattatgatattttgcgtaca
gagttgtttaaaaagcttgcctaa

DBGET integrated database retrieval system