KEGG   Pseudoalteromonas sp. SM9913: PSM_A0785Help
Entry
PSM_A0785         CDS       T01374                                 

Definition
phosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:844216..844704
Genome map
AA seq 162 aa AA seqDB search
MAQIFISLGSNINKAEHIRRALVALNKHFKNTQHSSVFESEAVGFAGNNFYNSVLAATTE
MALEDVCALLKQIERDNGRKANDKKFSPRTLDLDLLFYDDVICESPAQLPRDEITKNAFV
LQPLAEVAPDFYHPVAKKTIAQIWNAYNNPQQKLWKVEFSNP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaatatttattagtttagggtcaaatattaataaagcagagcatatcaggcgt
gctttagtggcgttaaataaacactttaaaaatacacaacattcttcggtatttgaaagt
gaagcagtgggttttgccggtaataacttttacaactccgtactcgctgccactaccgaa
atggcgcttgaagatgtgtgtgcgttattaaaacaaatagagcgcgataatggtcgcaaa
gcaaatgataaaaaatttagcccgcgcaccttggatctcgatttactcttttacgatgat
gtcatttgtgagagcccagctcaactaccacgtgacgaaattaccaaaaatgcctttgta
ttacagcctttagcagaggtggctcctgatttttatcaccctgtagcaaaaaaaacgatt
gcccaaatatggaatgcatataacaaccctcaacaaaaactatggaaggtggagttttct
aacccatga

DBGET integrated database retrieval system