KEGG   Pseudoalteromonas sp. SM9913: PSM_A1037Help
Entry
PSM_A1037         CDS       T01374                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00071  Fatty acid degradation
psm00280  Valine, leucine and isoleucine degradation
psm00281  Geraniol degradation
psm00310  Lysine degradation
psm00362  Benzoate degradation
psm00380  Tryptophan metabolism
psm00410  beta-Alanine metabolism
psm00640  Propanoate metabolism
psm00650  Butanoate metabolism
psm00903  Limonene and pinene degradation
psm00930  Caprolactam degradation
psm01040  Biosynthesis of unsaturated fatty acids
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
psm01212  Fatty acid metabolism
Module
psm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSM_A1037 (fadJ)
   00650 Butanoate metabolism
    PSM_A1037 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PSM_A1037 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PSM_A1037 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSM_A1037 (fadJ)
   00310 Lysine degradation
    PSM_A1037 (fadJ)
   00380 Tryptophan metabolism
    PSM_A1037 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSM_A1037 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSM_A1037 (fadJ)
   00281 Geraniol degradation
    PSM_A1037 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSM_A1037 (fadJ)
   00930 Caprolactam degradation
    PSM_A1037 (fadJ)
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSM_A1037 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSM_A1037 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSM_A1037 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADT67982
Position
I:1099898..1102090
Genome map
AA seq 730 aa AA seqDB search
MTDSVFNLTVDDNKIAVVTIDVPGEKMNTLRDSFADDLKALLAQAKEHAVKGMVFISGKS
DNFIAGADVKMLDSVQKREDALAISELCHQAFFDMKKLPYTTVSAIHGAALGGGLEFALA
CDYRVGTDSDLTKIGLPEVQLGLLPGGGGTQRLTKIVGIQKALEWMLTGKQIRPKQAKKA
GVLDDCVPQSVLLKVAKEFAAKKKPQAKEPKLDKISKLLESNPFGRNFIFKKAKENVLKK
TGGHYPAPLAIIKAVRASVELDEMKAYKTEAEGFATLVMSDESKALRGIFFATTEMKKEW
RNDDAPAISKTAVLGGGLMGAGIAHVSAVKAKLPVRIKDVAEQGISNAMNYTYKILDKRL
KRRIMSKADMQLTMNRITGTTDYSGFKHIDLVIEAVFEDLELKQGMVADVEQHCQANTIF
ASNTSSLPISQIAAKAARPENVIGLHYFSPVEKMPLVEIIPHEGTSKETIARVVNFARKQ
GKTPIVVKDMAGFYVNRILAPYLNEAANLMLAGEPIEKIDAALVEFGFPVGPLALLDEVG
IDIGSKIAPILEKELGERFKGPDAFSRMIDSKRLGRKTGRGFYEYDKKGKKVDESVYELL
GVTPAPRLNKNEIAKRCISQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPPFLGGPFSY
MDKLGAGKISSDMSTLANSNAIFTPCDTLLAMADKGDKFYTTAANKAEVELAQGDDKSTD
TPNETTEHKD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacagattcagtatttaatttaacggttgatgataacaaaatagccgtagtgaccatt
gatgtgccgggtgagaaaatgaataccctgcgagatagctttgctgatgatttaaaagca
ttattagcacaagctaaagagcacgcagttaaaggtatggtatttattagtggtaaaagc
gataactttattgctggtgccgatgttaaaatgctagacagcgtgcaaaagcgtgaagat
gcattagctattagcgaattatgccatcaagcattttttgatatgaaaaagcttccgtac
accacagttagtgctatacatggcgcagcgcttggtggcggtttagaatttgctttagcc
tgtgattaccgcgtaggtacagatagcgatttaactaaaattggtttaccagaagtgcaa
cttggtttattacctggcggtggtggtacacagcgcttaactaaaatcgtgggcattcaa
aaagcccttgagtggatgctaaccggaaaacaaattcgtcctaaacaagctaaaaaagcc
ggtgtattggatgattgtgtaccacaaagcgtactgctaaaagtggccaaagagtttgcg
gcgaagaaaaagccacaagctaaagagcctaaacttgataagatcagtaagttattagaa
tcaaacccgtttggtcgtaactttatctttaaaaaagctaaagaaaacgttcttaaaaaa
accggtggtcattaccctgcgccgcttgcaattattaaagcggtacgtgcaagcgtagag
cttgatgaaatgaaagcgtataaaaccgaagcagaaggttttgccacattggtaatgagt
gatgagtctaaggcgctgcgcggtattttctttgcaaccactgaaatgaaaaaagaatgg
cgcaatgatgatgctcccgcgattagtaaaactgccgtgttaggtggtggcttaatgggt
gcaggtattgcccatgtgagtgcggtcaaagctaaattgccggtgcgaattaaagatgtg
gcagagcagggcataagtaatgccatgaactacacatacaaaattttagataagcgtctt
aaacgccgtattatgtctaaagccgatatgcagttaaccatgaaccgcattaccggcact
accgattacagcggttttaaacacatagatttagtgatagaagccgtatttgaagattta
gagcttaagcaaggtatggttgctgatgtagagcagcattgccaagcgaatactattttc
gcaagtaatacttcgtcattacctatttcgcaaattgcagctaaagcagcgcgtcctgaa
aatgtaattggtttacattatttctcaccagtagagaaaatgccactggtagaaattatt
cctcacgaaggcacctcaaaagaaacgattgctcgtgtagttaactttgcgcgtaagcaa
ggtaaaacgccaattgtggtaaaagatatggctggtttttatgttaaccgtattttagcg
ccatacctgaatgaggcggcaaacttaatgcttgccggtgagccaattgaaaaaattgac
gcagccttagttgagtttggttttccagtagggccgttggcactgcttgatgaagtcggt
attgatattggttctaaaatcgcgccaattcttgaaaaagaactcggtgagcgttttaaa
ggcccagatgctttctcgcgcatgattgattcaaaacgcttaggccgtaaaacgggtcgt
ggtttttatgaatacgacaagaaaggcaaaaaggttgatgagtcagtctatgagctacta
ggtgtaaccccagctccacgtttaaataaaaacgaaattgctaagcgttgtatctcacaa
atgcttaatgaggccgttcgctgtttagatgacggtattattgccagcccgcgtgatggt
gatattggtgctatttttggtattggtttcccaccgttcttaggtggcccgtttagctat
atggataaattaggcgcaggcaaaataagctctgatatgtctactctggctaacagcaac
gctatttttacaccttgtgatactttacttgcaatggctgacaagggcgataagttttac
acaacagccgctaataaagctgaagtggagttagcgcaaggtgatgataaatcaactgac
actccaaatgagacgactgaacacaaagattaa

DBGET integrated database retrieval system