KEGG   Pseudoalteromonas sp. SM9913: PSM_A1037Help
Entry
PSM_A1037         CDS       T01374                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSM_A1037 (fadJ)
   01212 Fatty acid metabolism
    PSM_A1037 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSM_A1037 (fadJ)
   00650 Butanoate metabolism
    PSM_A1037 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PSM_A1037 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PSM_A1037 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSM_A1037 (fadJ)
   00310 Lysine degradation
    PSM_A1037 (fadJ)
   00380 Tryptophan metabolism
    PSM_A1037 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSM_A1037 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSM_A1037 (fadJ)
   00281 Geraniol degradation
    PSM_A1037 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSM_A1037 (fadJ)
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSM_A1037 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSM_A1037 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSM_A1037 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1099898..1102090
Genome map
AA seq 730 aa AA seqDB search
MTDSVFNLTVDDNKIAVVTIDVPGEKMNTLRDSFADDLKALLAQAKEHAVKGMVFISGKS
DNFIAGADVKMLDSVQKREDALAISELCHQAFFDMKKLPYTTVSAIHGAALGGGLEFALA
CDYRVGTDSDLTKIGLPEVQLGLLPGGGGTQRLTKIVGIQKALEWMLTGKQIRPKQAKKA
GVLDDCVPQSVLLKVAKEFAAKKKPQAKEPKLDKISKLLESNPFGRNFIFKKAKENVLKK
TGGHYPAPLAIIKAVRASVELDEMKAYKTEAEGFATLVMSDESKALRGIFFATTEMKKEW
RNDDAPAISKTAVLGGGLMGAGIAHVSAVKAKLPVRIKDVAEQGISNAMNYTYKILDKRL
KRRIMSKADMQLTMNRITGTTDYSGFKHIDLVIEAVFEDLELKQGMVADVEQHCQANTIF
ASNTSSLPISQIAAKAARPENVIGLHYFSPVEKMPLVEIIPHEGTSKETIARVVNFARKQ
GKTPIVVKDMAGFYVNRILAPYLNEAANLMLAGEPIEKIDAALVEFGFPVGPLALLDEVG
IDIGSKIAPILEKELGERFKGPDAFSRMIDSKRLGRKTGRGFYEYDKKGKKVDESVYELL
GVTPAPRLNKNEIAKRCISQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPPFLGGPFSY
MDKLGAGKISSDMSTLANSNAIFTPCDTLLAMADKGDKFYTTAANKAEVELAQGDDKSTD
TPNETTEHKD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacagattcagtatttaatttaacggttgatgataacaaaatagccgtagtgaccatt
gatgtgccgggtgagaaaatgaataccctgcgagatagctttgctgatgatttaaaagca
ttattagcacaagctaaagagcacgcagttaaaggtatggtatttattagtggtaaaagc
gataactttattgctggtgccgatgttaaaatgctagacagcgtgcaaaagcgtgaagat
gcattagctattagcgaattatgccatcaagcattttttgatatgaaaaagcttccgtac
accacagttagtgctatacatggcgcagcgcttggtggcggtttagaatttgctttagcc
tgtgattaccgcgtaggtacagatagcgatttaactaaaattggtttaccagaagtgcaa
cttggtttattacctggcggtggtggtacacagcgcttaactaaaatcgtgggcattcaa
aaagcccttgagtggatgctaaccggaaaacaaattcgtcctaaacaagctaaaaaagcc
ggtgtattggatgattgtgtaccacaaagcgtactgctaaaagtggccaaagagtttgcg
gcgaagaaaaagccacaagctaaagagcctaaacttgataagatcagtaagttattagaa
tcaaacccgtttggtcgtaactttatctttaaaaaagctaaagaaaacgttcttaaaaaa
accggtggtcattaccctgcgccgcttgcaattattaaagcggtacgtgcaagcgtagag
cttgatgaaatgaaagcgtataaaaccgaagcagaaggttttgccacattggtaatgagt
gatgagtctaaggcgctgcgcggtattttctttgcaaccactgaaatgaaaaaagaatgg
cgcaatgatgatgctcccgcgattagtaaaactgccgtgttaggtggtggcttaatgggt
gcaggtattgcccatgtgagtgcggtcaaagctaaattgccggtgcgaattaaagatgtg
gcagagcagggcataagtaatgccatgaactacacatacaaaattttagataagcgtctt
aaacgccgtattatgtctaaagccgatatgcagttaaccatgaaccgcattaccggcact
accgattacagcggttttaaacacatagatttagtgatagaagccgtatttgaagattta
gagcttaagcaaggtatggttgctgatgtagagcagcattgccaagcgaatactattttc
gcaagtaatacttcgtcattacctatttcgcaaattgcagctaaagcagcgcgtcctgaa
aatgtaattggtttacattatttctcaccagtagagaaaatgccactggtagaaattatt
cctcacgaaggcacctcaaaagaaacgattgctcgtgtagttaactttgcgcgtaagcaa
ggtaaaacgccaattgtggtaaaagatatggctggtttttatgttaaccgtattttagcg
ccatacctgaatgaggcggcaaacttaatgcttgccggtgagccaattgaaaaaattgac
gcagccttagttgagtttggttttccagtagggccgttggcactgcttgatgaagtcggt
attgatattggttctaaaatcgcgccaattcttgaaaaagaactcggtgagcgttttaaa
ggcccagatgctttctcgcgcatgattgattcaaaacgcttaggccgtaaaacgggtcgt
ggtttttatgaatacgacaagaaaggcaaaaaggttgatgagtcagtctatgagctacta
ggtgtaaccccagctccacgtttaaataaaaacgaaattgctaagcgttgtatctcacaa
atgcttaatgaggccgttcgctgtttagatgacggtattattgccagcccgcgtgatggt
gatattggtgctatttttggtattggtttcccaccgttcttaggtggcccgtttagctat
atggataaattaggcgcaggcaaaataagctctgatatgtctactctggctaacagcaac
gctatttttacaccttgtgatactttacttgcaatggctgacaagggcgataagttttac
acaacagccgctaataaagctgaagtggagttagcgcaaggtgatgataaatcaactgac
actccaaatgagacgactgaacacaaagattaa

DBGET integrated database retrieval system