KEGG   Pseudoalteromonas sp. SM9913: PSM_A1204Help
Entry
PSM_A1204         CDS       T01374                                 

Definition
exonuclease V, alpha chain with recC and recD: 5' and 3' nuclease, ATPase, recombinase, helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSM_A1204
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSM_A1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1293554..1295572
Genome map
AA seq 672 aa AA seqDB search
MSDLNQQPGLFDDFDDAPVDESSLLNEQLADSVTQTPKVVPLLSYLTEQHRVRVVDVKLA
ELLSGNNTEHDYDELFYIILMLCLSQQSQHSCLTLTEIDWANPFNLRQSDFTKLEGTVPD
TLTPFSDDFTTEAAISYLHAHHSVGDHKPLQLFNQRLYFSRLAGYEQTLAQRLLAMSERQ
LNIDDEVLTELLTRYFPDNPTLDIDWQKVACAIAATKGFSVITGGPGTGKTTTVTKLLAI
LQSLYQAAPLSIKLVAPTGKAAARLTESILGAKNKLTEIPADINALIPQSAQTIHRLLGV
KPFTNKFRHDKSNPLHVDVLIIDEASMVDLSLMAKLIEALPAHARLILLGDKDQLASVDT
GSVMSDLCQGLVLGQTPQYSKARCEQLNKVCFNGAAKLGAQTQSEFKLADCIAFLQHSYR
FDAQSGIGQLALAVNTNDRGILNYVEQHSTQGHFSDVILDYDFVSTPIEKLINSAASHYG
DYLTLIAQGASVAKVHEAFARYQLLAAVREGDYGVNSLNQRIERVLQQQGLISVNPNQRH
YTGMPIMISQNDYQLKLFNGDIGILMPDDSGQLKALFIDEQGNERAFSPARLPAHDKVYV
MTIHKSQGSEFSYTAMVLPPLKQASVGINRQLVYTGITRAKQTFELVADKKVLQLAMGKS
VSRASGLYERLV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttaaaccaacaacccggtttgtttgatgactttgacgacgcgcctgttgat
gagtcgtcgttactcaatgaacaactagcggactctgtaactcaaacacctaaagttgtg
ccgctgcttagctatttaactgagcagcaccgcgtacgtgttgtggatgtaaagctggct
gaattactcagtggtaacaatactgaacatgattatgacgaattattttatattatttta
atgctgtgtttatcacagcaaagccagcatagttgtttaactctaacagaaattgattgg
gctaatccgtttaatttacgccaaagcgactttactaaattagaaggcaccgtacctgac
actctcaccccatttagtgacgattttacgactgaggcagcaataagttacttacacgcg
catcacagtgtgggggatcacaagccgctgcaattgtttaatcagcggttgtatttttcg
cgtttagcagggtatgagcaaactttagcgcagcgattactggcaatgagtgagcgacaa
ctcaatattgatgatgaagtccttactgagttattaacacgctactttcctgataatcca
acgcttgatattgattggcaaaaggtcgcttgtgccattgctgcaacaaagggctttagt
gtgatcaccggtggccccggaaccggtaaaactaccacggtgacaaagctgttagccatt
ttacagtcgttatatcaggctgcaccattgagcataaaattagtagcacccacaggtaaa
gcagcggcgcgattaacagagtcaattttaggagctaaaaataagctcacagaaataccg
gctgatattaatgcgttgatcccgcaaagtgcgcaaaccattcatcgtttgttgggagtt
aagccatttactaataaattcaggcacgataaaagcaatccgttgcatgttgatgtattg
attattgatgaggccagtatggtcgatttatcgctcatggctaaattaattgaggccttg
ccagcgcatgcccgattgattttactcggcgataaagaccaactcgcctcggttgatacc
ggcagtgtaatgagtgatttatgccaaggtttagtgcttgggcaaacaccgcaatattca
aaagcacgctgtgagcaattaaataaggtgtgttttaatggcgcagctaaacttggcgcg
caaactcagagtgagtttaaactggctgattgcattgcctttttacaacatagttatcgc
tttgatgcccaaagtggcataggccaattggctttggctgttaataccaatgatcggggt
attttaaattatgttgaacaacacagtacgcaagggcattttagcgatgttattttagac
tacgattttgtctctacaccgattgaaaagcttataaacagcgcggcaagtcactacggt
gattatttaacactgattgcccaaggagctagtgttgccaaagtgcatgaggcttttgcc
cgctatcaattacttgccgcggtgcgtgaaggcgattacggcgttaatagtttaaatcaa
cgtattgagcgtgtattgcaacagcaagggttaattagcgttaaccctaatcagcggcat
tacacgggtatgcctattatgattagccaaaacgattatcaacttaaactttttaacggc
gatataggtattttaatgcctgatgacagtggccaactcaaagcactgtttattgatgag
cagggtaatgaacgtgcattttcacctgcacgactcccagcgcacgataaagtgtatgtt
atgaccattcataaatcgcaaggctcagagtttagttacactgctatggtattgccacca
cttaaacaagcgagcgtcggtattaaccggcaattagtgtataccggtattacccgtgca
aagcagacctttgagctggtagcagataaaaaagtgctgcaactggcgatgggtaaaagt
gtgtcacgggcatcaggactctatgagcgattagtgtaa

DBGET integrated database retrieval system