KEGG   Pseudoalteromonas sp. SM9913: PSM_A1382Help
Entry
PSM_A1382         CDS       T01374                                 

Definition
Glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_A1382
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PSM_A1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1495773..1498178
Genome map
AA seq 801 aa AA seqDB search
MKKYNLITATILAAGLVGCGVQNTQTSAVAQTSVSAPGAPGEAPFWAYAGKTGIGTSFEQ
YQNGHYSNEAPTGKVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVVGKDFTVTEADDL
DVTIDYLYKDDKGRPLSLAYKVVSKDKQGRFSLEKHIFTDPDGQSLFVRSIFNTQLDGVK
AYVTVNPYINNNGLDDFAKTTEQGLVAWQGDNYLSLQGAQPFKQTSVGFTGVSDGLSQLK
TTQQLTRVYKNTGEQSGNVSLLAELGAIGENSQFDLTLSFGNSEQTSFKQGQATLAKGYQ
AVLDNYNGKGEALGWQDYLQSLAPLNNMSEQTADNGKLLYTSAMVLKAQEDKTHAGALIA
SLSNPWGETVSAKTGSTGYKAVWVRDFYQVAMAFMAMGDNATAKTAFEYLEKVQVNSKTP
GNKGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQADVLTDAELSDWYSRMLKP
AADFLVEGGRANILWNDTQITPPATQQERWEEQEGYSPSTTAAVIAGLITAADIAKMAGD
EVNAKRYLATAKSYNADIESMMFTTEGNLESNATDGEYFIRIGQDKDANSNTKINANNGR
EGFNKKQILDGGFLELVRYGVRDALAPSIVKTLPEYDNETLTDNLQVKYSFEFTDGSGTF
AGYRRYGNDGYGEDEVTGANYAQGGKNSPGQRGRVWPFFTGERGHYEIAAANANNTLDAT
KQQAIKNSYVKGLEQFANEGMMLPEQVWDGVGVNKAGYTLGEGTNSATPLAWTHAEYVKL
VRSLSDKQVWDHYPVVTKALK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataacctaattaccgcgacaatattggccgcaggccttgtaggttgtggt
gtgcaaaatacgcaaaccagtgcagtagcgcaaacatcagtgagtgcgccaggcgcacca
ggcgaagccccattttgggcatacgcaggcaaaactgggataggcacgtcttttgagcaa
taccaaaatggccattacagtaacgaagcacctacaggtaaagtgtcaaaagtatggttt
tcgattgccaaagggatgatcaccgaaaccatgttcgggcttattcatcaagcgcaaatt
aaagacatgcaatttgttgtagtcggaaaagattttacagtcaccgaagctgacgattta
gacgttaccattgattacttatacaaagacgataaaggccgcccgttatcattagcatac
aaagtagtaagcaaagataagcaaggtcgctttagcctcgaaaaacatatatttaccgat
ccagacggtcaaagcttatttgtacgcagtatttttaatacccagcttgacggtgtaaaa
gcatatgtaacagttaacccgtatataaacaacaacggcttagatgactttgcaaaaacc
accgagcaagggttggtagcgtggcagggcgataattatttgtcattgcaaggtgcacag
ccatttaaacaaacaagtgttggttttacaggtgtgagtgatggtttaagccagcttaaa
acaactcagcagcttacccgcgtttataaaaataccggtgaacaatcgggtaatgttagc
ctacttgcagagctgggtgcaattggtgaaaacagccagttcgatttaaccctaagcttt
ggcaatagcgaacaaaccagctttaaacaaggccaagctacgttagccaaaggttaccaa
gcggtgcttgataattacaacggtaaaggcgaagcacttggttggcaagactacctgcaa
agccttgcaccgctaaataacatgagcgaacaaaccgctgataacggcaagttactttat
accagtgctatggtgttaaaagcccaagaagacaaaacccatgccggggcacttattgcc
tctctatctaacccatggggcgaaaccgtatcggctaaaacaggttctactggttataaa
gcggtatgggtgcgcgacttttatcaagttgccatggcgtttatggccatgggcgataat
gcgaccgctaaaaccgcattcgaataccttgaaaaagttcaagtaaacagcaaaaccccg
ggcaataaaggtgatactgggtggtttttacaaaaaacacacgtagatggcgaacttgaa
tgggtaggcgtacagctagaccaaaccgctatgcctattatgctagcgtggaagcttcat
caagctgatgtattaacagatgcagagctgagcgattggtatagccgtatgttaaagccc
gcggcagactttttagttgagggtggtcgtgcaaacattctatggaacgacacacaaata
acgccgccagccactcagcaagaacgctgggaagagcaagaagggtattcgccatcaacc
accgctgctgttattgccggtttaattaccgccgctgatattgcaaaaatggcaggagat
gaggtgaatgctaaacgctaccttgcaacggcaaaaagttacaacgccgatatagaaagc
atgatgtttaccaccgaaggtaatttagaatcaaacgcaacagacggcgagtattttata
cgtattggccaagacaaagacgccaattcaaatactaaaattaacgccaacaatggccgt
gaagggtttaataaaaagcaaattctcgatggtgggtttttagagctcgttcgctatggt
gtacgtgatgcgctagcgcctagcatagtaaaaacactgccagaatatgataacgaaacc
ctaacagataacttacaagttaaatacagctttgagtttactgatggcagcggcacattt
gcaggctaccgccgttatggtaacgacgggtacggtgaagatgaagtaactggcgctaac
tatgcgcaaggtggaaaaaatagcccagggcaacgtgggcgagtttggccattttttacc
ggtgaacggggccattatgaaattgccgccgcaaatgctaataataccttagatgcaaca
aaacagcaggctattaaaaatagctatgtaaaagggctagagcaatttgctaacgaaggt
atgatgctaccagaacaagtatgggatggcgtaggcgtaaataaagcaggatacacgtta
ggcgagggtacaaactcggccacaccactggcgtggacgcatgctgaatacgtgaagcta
gtgcgctcactaagcgacaaacaagtatgggatcattatccggtggtaactaaagcacta
aaataa

DBGET integrated database retrieval system