KEGG   Pseudoalteromonas sp. SM9913: PSM_A1392Help
Entry
PSM_A1392         CDS       T01374                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm00052  Galactose metabolism
psm00500  Starch and sucrose metabolism
psm00520  Amino sugar and nucleotide sugar metabolism
psm00521  Streptomycin biosynthesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
Module
psm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A1392
   00052 Galactose metabolism
    PSM_A1392
   00500 Starch and sucrose metabolism
    PSM_A1392
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A1392
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSM_A1392
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSM_A1392
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSM_A1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADT68325
Position
I:1506180..1507178
Genome map
AA seq 332 aa AA seqDB search
MGLHSSTHFDPILVADIGGTNARFALITGFDESSNQFTIEHNHTFPSANYGSLESATEYY
LSTVSHITPKRACLAVAGPINAGQVHLTNLGWHFSVNDFKHHFDLAQLSVINDFAAFAYA
APYLDPSQNVTVKPGQADESANIGVMGPGTGFGAACLVRTAHSCAVMSSEGGHISLAAVN
QLDGQLIQELKKDHPHVSVETVFSGPGIAHLYKAMAAVKGVAAKNLDAAQISSLANSGEC
EVCDATLNQFCDWIGSVAGDLALAYGALGGLYIGGGILPRMQARLLESRFIERFSQKGIM
SQYTGQIPVTLVTQDNIPLIGAAACLHTSQQD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggtttacactctagcacacactttgatcctattctggttgccgatattggcggcaca
aatgctcgttttgcgttgatcactggcttcgacgaatcaagtaatcaatttaccattgag
cataatcatacgtttcccagtgctaactatggatcgctcgaaagtgctaccgagtactac
ttatcaacagtgtctcatataacccctaaacgcgcatgccttgcagtagcaggccctata
aatgcagggcaagttcatttaactaatttaggttggcactttagcgttaatgattttaaa
caccactttgaccttgctcaattaagcgttataaatgactttgctgcttttgcctacgca
gcaccgtatttagacccttcacaaaatgtcactgttaaacctggtcaagcggatgagtct
gccaatataggtgtaatgggcccaggcactggttttggtgcagcgtgcttagtgagaacg
gcacattcgtgcgcggtgatgagttcagaaggcgggcatatttcgttagcagccgttaat
caactcgacggtcaacttattcaagaactcaaaaaagatcaccctcatgtatcggtagaa
acggtattttcgggccctggcattgctcatttgtataaagccatggctgcggttaaaggg
gtggcggcaaaaaatttagatgccgcacaaattagcagcttagccaatagcggtgaatgt
gaagtgtgtgatgcaacgcttaatcaattttgtgactggattggcagtgttgcgggcgat
ttagcattggcctacggcgctttaggcggcctttatattggcggtggaattttaccacgc
atgcaagctcgtttacttgaaagtcgttttattgagcgcttttcgcaaaaaggtattatg
tcgcagtacacaggtcaaattccggtgacgttagtaacacaagacaacatcccattaatt
ggagctgccgcgtgtttgcatacgagccaacaggattaa

DBGET integrated database retrieval system