KEGG   Pseudoalteromonas sp. SM9913: PSM_A1533Help
Entry
PSM_A1533         CDS       T01374                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSM_A1533
   01230 Biosynthesis of amino acids
    PSM_A1533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A1533
   00030 Pentose phosphate pathway
    PSM_A1533
   00051 Fructose and mannose metabolism
    PSM_A1533
   00052 Galactose metabolism
    PSM_A1533
  Energy metabolism
   00680 Methane metabolism
    PSM_A1533
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSM_A1533
Protein phosphatases and associated proteins [BR:psm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PSM_A1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1654364..1655332)
Genome map
AA seq 322 aa AA seqDB search
MQPIKHIAVLTSGGDAPGMNTALFSIVKTAQQHGIKVSGVRKGFEGLIDNDLVTLDCKSL
QQTMHLGGTVLKTARSERFRGDAGRNLALATIEHNNIDALIVIGGDGSFRGCLWLSQITN
IPYIGIPGTIDNDIAGTDYTLGFDTAVNTSMQCIDNIRDTAESHNRVFVIEVMGRDSGYI
GTYAGLTSGADSILIPESDEDITYLVNKISDYHSEHAFIVVVSEGDEIGVEHICEKISTV
NPSIDLRVTKLGHLQRGGNPSAADRMLAIRLGVHSVKALCAGESAKMVGILNNKVSNTPM
QDVAKQHVINEELQGLLSVFCR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattaaacacattgccgtattaacctcagggggcgatgcgcctgggatgaac
accgcattattttccatagtaaaaaccgctcaacaacatggaataaaagtgtcgggcgtt
cgaaaagggtttgagggtttaattgataatgatttagtgacacttgattgcaaaagccta
caacaaaccatgcacttaggtggtactgtgttaaaaacagcgcgtagtgaaagatttaga
ggtgacgccggtagaaatctagcactagctacaattgaacataataatattgacgcttta
attgtgataggtggagatggctcatttagagggtgtttatggttatcacaaattactaac
ataccgtatataggcattccaggcactattgataatgatattgcgggtacagattacacc
ttagggtttgatacagcagtaaacacatcaatgcaatgtattgataatattagagatact
gcagaatcacataatagggtgtttgttattgaagtaatgggacgtgattctggttatatt
ggcacttatgccggtttaacctctggcgccgattcgatattaatacctgaaagtgatgaa
gacataacttatttagtgaataaaattagtgattatcacagtgagcatgcttttattgtg
gtggtatctgaaggtgatgaaattggcgttgagcatatatgtgagaaaataagtaccgtt
aatcccagtatagatttgcgcgtaactaagctagggcacttacaacgcggcggtaatcca
tctgcagcggatcgtatgttagcaataagattaggcgtacacagtgttaaggctttatgt
gctggagaaagcgctaaaatggtgggtattttaaataacaaagtatcaaatactcctatg
caagatgttgcaaaacaacatgttataaatgaagagctacaagggctgttatctgtattt
tgccgctaa

DBGET integrated database retrieval system