KEGG   Pseudoalteromonas sp. SM9913: PSM_A1617Help
Entry
PSM_A1617         CDS       T01374                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00020  Citrate cycle (TCA cycle)
psm00640  Propanoate metabolism
psm00660  C5-Branched dibasic acid metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
Module
psm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSM_A1617 (sucC)
   00640 Propanoate metabolism
    PSM_A1617 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSM_A1617 (sucC)
Enzymes [BR:psm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSM_A1617 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADT68545
Position
I:complement(1732885..1734051)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSQGFACDTPEEAAAAAEKIGGDMWVVKTQVHAGGRGKAGGV
KLVKTIDEVKAFAANWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRASRK
VVFMASTEGGVEIETVAEETPELIHKAEIDPLVGPQAYQARELGFKLGLNPTQMKQFVKI
FMGLGNMFNDFDFALLEINPLVITDEGNLHCLDGKIGIDGNALYRQPKIREMHDPSQEDA
REAHAASFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVSE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVNVPVVVRLEGTNAELGREV
LAKSDLNIIAAESLTDAAEKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaacaactttttgccgaatatggtttaccagtttct
caaggtttcgcttgcgatacacctgaagaagctgcagcagctgctgaaaagattggcggc
gatatgtgggttgttaaaactcaggttcacgcaggtggacgtggtaaagctggcggtgta
aagctagttaaaactatcgacgaagttaaagcgtttgcagctaactggttaggtaaaaac
ctagttacttaccaaacagacgagaaaggccagccagttgctaaaattttagtagaaagc
tgtactgacatcgctaacgaactgtacctaggtgctgttgttgaccgtgcttctcgtaaa
gttgtgttcatggcgtctactgaaggcggcgttgaaattgaaactgttgctgaagaaaca
ccagaacttatccacaaagctgagatcgatccattagtaggtcctcaagcttaccaagca
cgtgagcttggttttaaattgggtcttaacccaacgcaaatgaaacagtttgttaagatc
ttcatgggtcttggtaatatgttcaacgatttcgatttcgcattacttgaaatcaacccg
ctagtaatcacagatgaaggtaaccttcactgtctagatggtaaaatcggtatcgatggt
aatgcactttaccgtcaacctaaaatccgtgaaatgcacgatccatctcaagaagatgcg
cgtgaagctcacgcagcaagcttcgagcttaactacgtagcccttgatggtaacgtaggt
tgtatggttaacggtgcaggcctagcaatgggtactatggacatcgtaaacctacacggt
ggcaagccagctaacttcctagatgttggtggcggcgcaacgaaagaacgtgtatctgaa
gcattcaaaattatcctttcagatgacaacgttaaagctgttttagttaacatcttcggc
ggtatcgttcgttgtgacatgattgcagaaggcatcattggtgcagttaaagaagttggc
gtaaacgtaccagtagttgtacgtttagaaggtactaacgctgagctgggtcgtgaagta
cttgctaagtctgatctaaacatcatcgctgctgaatcattaacagacgcggctgaaaaa
gttgttgctgctgcggagggcaaataa

DBGET integrated database retrieval system