KEGG   Pseudoalteromonas sp. SM9913: PSM_A1618Help
Entry
PSM_A1618         CDS       T01374                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00020  Citrate cycle (TCA cycle)
psm00310  Lysine degradation
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
Module
psm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSM_A1618 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSM_A1618 (sucB)
Enzymes [BR:psm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSM_A1618 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N GCV_H HTH_17 YqfD
Motif
Other DBs
NCBI-ProteinID: ADT68546
Position
I:complement(1734229..1735746)
Genome map
AA seq 505 aa AA seqDB search
MSTEIKVPVLPESVADASVATWHVSVGDKVSRDQNLVDIETDKVVLEVVAQNDGVITEIS
QEEGATVLGDQVIGLIGDAQEASPSKEPKEDSSASEKSEDAPAAQSAPASEGKEVDIKVP
VLPESVADATIATWHVQPGDAVTRDQNLVDIETDKVVLEVVAQEDGVMGEIIHDEGDTVL
GEQVIGKVKAGAAPAKSDAKADAPAAKEESSSDSSDVLTPSVRRLIAEKGLDASKIKGSG
KNGRVTKEDVDQFLKSPAPAAKAEAAPAAPMGDRTQKRVPMTRLRKTIANRLLEAKNSTA
MLTTFNEVNMKPIMDLRKQYQEVFEKRHGIRLGFMSFYVKAVTEALKRFPDVNASIDGDD
IVYHNYFDISIAVSTPRGLVTPVLKDCDKLSVAEIEKGIRELALKGRDGKLTLDDMTGGN
FTITNGGVFGSLLSTPIINLPQSSILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRQID
GKESVGFLVTIKELLEDPTRLLLDV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaattaaagttcctgttcttcctgagtcggttgcagatgcttccgttgct
acatggcatgtaagtgttggcgacaaagtaagccgtgaccaaaacttagtagatattgaa
acagacaaagtggttttagaagtggttgcacaaaatgacggtgtgatcactgaaatttca
caagaagaaggtgctacggtacttggtgaccaagtgatcggtttaattggtgatgcgcaa
gaagcatcaccaagtaaagagccaaaagaagatagctcagcatcagaaaaatcagaagac
gcgccggcggcgcaatcagcaccagcatcagaaggtaaagaagtggatattaaagtacct
gtacttccagaatcagttgcagatgcaacaattgctacttggcatgttcaaccaggtgac
gcggtaacacgcgaccaaaacttggttgatattgaaacagataaagttgtacttgaagtg
gttgcccaagaagacggcgttatgggtgaaatcattcatgacgaaggcgatactgttctt
ggtgagcaagtaattggtaaagtaaaagcaggcgctgcacccgctaaatctgacgcaaaa
gcggatgcaccagcagccaaagaagaaagctcaagcgacagttcagatgtgttaacgcca
tcagttcgtcgtttaattgctgagaaaggccttgatgcatcaaaaatcaaaggttcaggt
aaaaatggtcgtgtgactaaagaagatgttgatcaattcttgaaatcacctgcgccagca
gcaaaagcagaagcagcgccagcagcacctatgggtgaccgcacgcaaaaacgtgtgcct
atgacacgtttacgtaaaaccattgcgaatcgtcttcttgaagcgaaaaactcaactgca
atgttaactacatttaacgaagttaacatgaagccaatcatggatcttcgtaagcagtac
caagaagtatttgaaaagcgccacggtatccgtttaggtttcatgtctttctacgtgaaa
gcagtgactgaagcgttaaagcgtttcccagatgtaaatgcatcaattgacggcgatgat
attgtttaccacaactatttcgacatcagcattgctgtttctacacctcgtggcttagta
acacctgtacttaaagactgtgacaagctatctgttgcagaaatcgaaaagggtattcgt
gagctagcgcttaaaggtcgtgatggtaagctaacgcttgacgatatgaccggcggtaac
ttcactatcaccaacggtggtgtattcggttcgttactatctactccaattattaactta
ccgcagtcttcaattttgggtatgcacaaaatccaagatcgtccaatggctgtaaacggt
aaagttgaaatcttacctatgatgtacttagcgttatcttacgatcaccgccaaatcgat
ggtaaagaatcagttggtttcttagtaacaattaaagagttacttgaagatccaacacgt
ttactgctggatgtttaa

DBGET integrated database retrieval system