KEGG   Pseudoalteromonas sp. SM9913: PSM_A1618Help
Entry
PSM_A1618         CDS       T01374                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSM_A1618 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSM_A1618 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSM_A1618 (sucB)
Enzymes [BR:psm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSM_A1618 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1734229..1735746)
Genome map
AA seq 505 aa AA seqDB search
MSTEIKVPVLPESVADASVATWHVSVGDKVSRDQNLVDIETDKVVLEVVAQNDGVITEIS
QEEGATVLGDQVIGLIGDAQEASPSKEPKEDSSASEKSEDAPAAQSAPASEGKEVDIKVP
VLPESVADATIATWHVQPGDAVTRDQNLVDIETDKVVLEVVAQEDGVMGEIIHDEGDTVL
GEQVIGKVKAGAAPAKSDAKADAPAAKEESSSDSSDVLTPSVRRLIAEKGLDASKIKGSG
KNGRVTKEDVDQFLKSPAPAAKAEAAPAAPMGDRTQKRVPMTRLRKTIANRLLEAKNSTA
MLTTFNEVNMKPIMDLRKQYQEVFEKRHGIRLGFMSFYVKAVTEALKRFPDVNASIDGDD
IVYHNYFDISIAVSTPRGLVTPVLKDCDKLSVAEIEKGIRELALKGRDGKLTLDDMTGGN
FTITNGGVFGSLLSTPIINLPQSSILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRQID
GKESVGFLVTIKELLEDPTRLLLDV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaattaaagttcctgttcttcctgagtcggttgcagatgcttccgttgct
acatggcatgtaagtgttggcgacaaagtaagccgtgaccaaaacttagtagatattgaa
acagacaaagtggttttagaagtggttgcacaaaatgacggtgtgatcactgaaatttca
caagaagaaggtgctacggtacttggtgaccaagtgatcggtttaattggtgatgcgcaa
gaagcatcaccaagtaaagagccaaaagaagatagctcagcatcagaaaaatcagaagac
gcgccggcggcgcaatcagcaccagcatcagaaggtaaagaagtggatattaaagtacct
gtacttccagaatcagttgcagatgcaacaattgctacttggcatgttcaaccaggtgac
gcggtaacacgcgaccaaaacttggttgatattgaaacagataaagttgtacttgaagtg
gttgcccaagaagacggcgttatgggtgaaatcattcatgacgaaggcgatactgttctt
ggtgagcaagtaattggtaaagtaaaagcaggcgctgcacccgctaaatctgacgcaaaa
gcggatgcaccagcagccaaagaagaaagctcaagcgacagttcagatgtgttaacgcca
tcagttcgtcgtttaattgctgagaaaggccttgatgcatcaaaaatcaaaggttcaggt
aaaaatggtcgtgtgactaaagaagatgttgatcaattcttgaaatcacctgcgccagca
gcaaaagcagaagcagcgccagcagcacctatgggtgaccgcacgcaaaaacgtgtgcct
atgacacgtttacgtaaaaccattgcgaatcgtcttcttgaagcgaaaaactcaactgca
atgttaactacatttaacgaagttaacatgaagccaatcatggatcttcgtaagcagtac
caagaagtatttgaaaagcgccacggtatccgtttaggtttcatgtctttctacgtgaaa
gcagtgactgaagcgttaaagcgtttcccagatgtaaatgcatcaattgacggcgatgat
attgtttaccacaactatttcgacatcagcattgctgtttctacacctcgtggcttagta
acacctgtacttaaagactgtgacaagctatctgttgcagaaatcgaaaagggtattcgt
gagctagcgcttaaaggtcgtgatggtaagctaacgcttgacgatatgaccggcggtaac
ttcactatcaccaacggtggtgtattcggttcgttactatctactccaattattaactta
ccgcagtcttcaattttgggtatgcacaaaatccaagatcgtccaatggctgtaaacggt
aaagttgaaatcttacctatgatgtacttagcgttatcttacgatcaccgccaaatcgat
ggtaaagaatcagttggtttcttagtaacaattaaagagttacttgaagatccaacacgt
ttactgctggatgtttaa

DBGET integrated database retrieval system