KEGG   Pseudoalteromonas sp. SM9913: PSM_A1622Help
Entry
PSM_A1622         CDS       T01374                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00020  Citrate cycle (TCA cycle)
psm00190  Oxidative phosphorylation
psm00650  Butanoate metabolism
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
psm01200  Carbon metabolism
Module
psm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSM_A1622 (sdhD)
   00650 Butanoate metabolism
    PSM_A1622 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSM_A1622 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADT68550
Position
I:complement(1741158..1741505)
Genome map
AA seq 115 aa AA seqDB search
MVLNQATLKRDGVQDFVSLRTTALIISAYAIFIIGYFLAMPEVTYEAWTGLFSNLAMKGA
TLITLVCIMVHTRIGLWQVLTDYVKNAKLRAFLGFVLNLMAVAYVAVGLIVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtcttaaatcaagcaactcttaaacgtgatggcgtacaagattttgtatctttacgc
acaacggcattaataatcagcgcgtatgcaatctttattattggctattttttagcaatg
ccagaagtcacatatgaagcctggacaggcctattctcaaacctagcaatgaaaggggca
acgttaatcaccctagtttgcattatggttcatacccgtatcggcctttggcaggttctt
accgactatgtaaagaacgctaaattgcgtgcttttttaggctttgtactaaacctaatg
gctgttgcttacgtagctgtgggtttaatcgttttatggggtgtttaa

DBGET integrated database retrieval system