KEGG   Pseudoalteromonas sp. SM9913: PSM_A1707Help
Entry
PSM_A1707         CDS       T01374                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSM_A1707 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSM_A1707 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSM_A1707 (trpB)
Enzymes [BR:psm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSM_A1707 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1831148..1832332
Genome map
AA seq 394 aa AA seqDB search
MQNPAYFGEFGGMFVPELLVPALKQLENEFNKAQKDPEFQAELSKLLNEYAGRPTPLTLT
RNLVKNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKKEVIAETGAGQHGVATALA
CALLGLKCRIYMGAKDVERQQPNVFRMKLMGAEVIPVTAGSGTLKDAVNEALRDWSANYQ
EAHYLLGTAAGPHPFPTIVREYQKIIGEEAKQQVLKAEGRLPDAVIACVGGGSNAIGMFT
DFIDEPSVKLIGVEPAGKGLDTHEHGATICKGTKGILHGTYTYIMQNTDGQIEESYSVSA
GLDYPAVGPQHAFLHETGRAQYVGITDTKALDAFQALAKHEGIIPALESSHALAYALEYA
EEQTQDSIIVINLSGRGDKDLAHVHKVLSEEGQL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccagcttattttggcgagtttggcggtatgtttgtacccgaactgcttgtc
cctgcgcttaagcagttagaaaacgaatttaataaagcacaaaaagatcctgaatttcag
gcagaactaagtaaattacttaacgagtatgcaggtcgtcctaccccgcttactttaacg
cgtaacttagttaaaaacccaaaagtaaaactgtacttaaagcgtgaagatttactccac
ggtggtgcgcacaaaacaaaccaagttttaggccaagctctgcttaccaaacgtatgggt
aaaaaagaagtcatagctgaaacaggcgccggccagcacggcgttgcaacggcacttgcc
tgtgcgttacttggactaaaatgccgcatttatatgggtgcaaaagatgttgaacgccaa
caaccaaatgtatttagaatgaaactcatgggcgctgaagttattccggtaaccgcaggc
tcgggtacattaaaagatgcggttaacgaggcattgcgtgattggtctgccaattatcaa
gaggctcattaccttttaggtactgcagcaggtcctcacccattcccgactattgtacgt
gaatatcaaaaaattattggtgaagaagcaaaacaacaagtacttaaagccgaaggccgt
ttgcctgatgcggttattgcgtgtgtaggcggtgggtctaacgcaattggtatgtttacc
gattttattgatgagccaagcgttaaactcattggcgttgaacctgcaggtaaagggtta
gacacgcacgaacatggcgcaactatctgtaaaggaacaaaaggtattttgcacggtact
tacacttatattatgcaaaatacagatggccaaattgaagagtcttactctgtatcggcg
ggactagattaccccgcagttggccctcaacatgcctttttgcacgaaactggccgtgct
caatatgtcggtattaccgacaccaaagcacttgatgcctttcaagcattagctaaacac
gaagggattattcctgcgcttgaatcaagtcatgcgctagcctatgccctcgaatatgca
gaagagcaaacgcaagacagtatcattgttattaatttaagtggtcgtggagacaaagac
ttagcccacgtacacaaggtattatcagaggaaggtcaactatga

DBGET integrated database retrieval system