KEGG   Pseudoalteromonas sp. SM9913: PSM_A1708Help
Entry
PSM_A1708         CDS       T01374                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSM_A1708 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSM_A1708 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSM_A1708 (trpA)
Enzymes [BR:psm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSM_A1708 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1832329..1833150
Genome map
AA seq 273 aa AA seqDB search
MSHVKTDRYGQMFAALKEQNQGAFVPFVTIGDPGKAQSIEIIKSLIDGGADGLELGIPFS
DPIADGPVIQKANIRALNVHINTQDCFDIIKEIREYNADIPIGLLLYSNLIFKRGLEKFY
TDAKAVGVDSILVADVPLHESKMFRKAAMANGIDPIFIATPNASDDTLRECASYGRGYTY
LLSRAGVTGTDTKAQMPATHVVTRLQEYHSAPALLGFGISTPEDVKAALKAGAAGAISGS
AVVKIIEANLDDLDAMTSQLKTFVSDMKAATAL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgtaaaaactgaccgttatggacaaatgtttgccgcgcttaaagagcaaaac
cagggtgcttttgtaccgtttgtaaccattggcgatccaggtaaagcgcaaagcatcgaa
attattaaaagcttaattgatggcggcgctgacgggcttgaattaggtattccgttttcc
gacccgattgccgatggccctgtcattcaaaaagccaatattcgtgccttaaacgtgcat
attaatacgcaagactgctttgatattattaaagagatccgtgaatataacgccgacatt
ccaattggtttgttattgtattcaaacttaatatttaaacgtggcttagaaaagttttac
accgatgcaaaagcagtgggtgttgactctattttagtggctgatgtgccattacatgag
tctaaaatgtttagaaaagccgccatggccaatggtatagacccgatttttatcgctaca
ccgaacgccagtgacgataccctgcgtgaatgtgcatcatacggccgtggctacacctac
ttgctttctcgtgctggggtaacaggtacagacaccaaagcacaaatgccagcaacccat
gtggttacgcgcttacaagagtaccacagtgcacctgcattattaggctttggtatttca
acgcctgaagatgtaaaagcggcacttaaagccggtgctgcgggtgctatttcgggctct
gctgtggtaaaaattattgaagcaaacttagatgatttagatgcgatgacctcgcagcta
aaaacatttgtaagcgatatgaaagccgctactgcgctttaa

DBGET integrated database retrieval system