KEGG   Pseudoalteromonas sp. SM9913: PSM_A1761Help
Entry
PSM_A1761         CDS       T01374                                 

Definition
Glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psm00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psm00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1885631..1886173
Genome map
AA seq 180 aa AA seqDB search
MDSIYQFNAPLCNNDDFSLSQLKGKTVLIVNTASKCHFSAQLCALEKLYQQYKNDGFTIL
AFPCNQFDKNEPLEGMAIKDYYQKHFSINFEVFNKVMVNGPDTHPLFSYLKSHTRGIAQN
RAIKWNFTKFLVNAQGQLVARYAPRTKPESLHNVITSCLESVPVIKPTTARLGVRSAVLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatagtatttatcaatttaacgcaccactttgtaataacgatgatttttctttgagt
cagctaaaaggaaaaacggttcttattgttaataccgccagtaaatgtcatttttctgcg
caattatgcgcgctagaaaagctatatcaacaatacaaaaacgatgggtttactatttta
gcctttccgtgtaatcaatttgataaaaatgagccattagagggaatggccattaaagac
tattatcaaaaacatttttcaattaattttgaggtgtttaataaggtcatggtaaatggc
ccagatacgcatccactgtttagttatttaaagtctcatacacgggggattgcacaaaac
cgagcaataaaatggaacttcactaagtttttagttaatgcacaagggcagctggttgct
cgctatgcaccgcgaactaaaccagagtcattacataatgtaataacaagctgcttagaa
tcagtgcccgttataaaaccgacgaccgctcgtttaggagtccgttcggctgtattaaaa
taa

DBGET integrated database retrieval system