KEGG   Pseudoalteromonas sp. SM9913: PSM_A1822Help
Entry
PSM_A1822         CDS       T01374                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1957385..1957993)
Genome map
AA seq 202 aa AA seqDB search
MQLSDSLTSLIEALRCQPGIGPKSAQRIAFHLLERDRKGGTQLGNALTKAMTAVGHCQSC
RTFTEQAQCDICLSTKRQDSGILCVVESPTDVLAIEQTGQYKGLYFVLMGHLSPIDGIGP
KEIGLDVLEQKLAQGGINEVILATNPSVEGETTAHYIAQLCHKNNVGASRIAHGIPVGGE
LDLVDGMTLMHAFSGRRLVSHE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaactttcagatagtttaacatcgcttattgaagcacttcgttgtcagcccggcatc
ggtccgaagtctgcccagcgtattgcatttcatttattagagcgcgaccgtaaaggcggc
actcagcttggcaatgcgctaacaaaagcgatgacggctgtagggcattgtcagtcgtgc
cgcacgtttaccgagcaagcacaatgtgatatttgcttaagcactaagcgccaagacagt
ggtattttatgtgttgttgaatcgccaacggatgtactcgccattgagcaaacaggtcaa
tacaaagggctttactttgtattaatggggcatttatcaccgattgatggcatagggcct
aaagaaattggccttgatgtactcgagcaaaagcttgcgcaaggcggtattaatgaagtc
attttagccacaaatccttcggttgaaggcgaaacaacggcgcattatattgctcagctt
tgccacaaaaacaatgtgggtgcatcgcgtattgctcatggtattcctgttggtggtgag
cttgatttagtcgatggaatgacgcttatgcatgcatttagcggtaggcgcttagtcagc
catgaatag

DBGET integrated database retrieval system