KEGG   Pseudoalteromonas sp. SM9913: PSM_A1822Help
Entry
PSM_A1822         CDS       T01374                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSM_A1822 (recR)
DNA repair and recombination proteins [BR:psm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSM_A1822 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1957385..1957993)
Genome map
AA seq 202 aa AA seqDB search
MQLSDSLTSLIEALRCQPGIGPKSAQRIAFHLLERDRKGGTQLGNALTKAMTAVGHCQSC
RTFTEQAQCDICLSTKRQDSGILCVVESPTDVLAIEQTGQYKGLYFVLMGHLSPIDGIGP
KEIGLDVLEQKLAQGGINEVILATNPSVEGETTAHYIAQLCHKNNVGASRIAHGIPVGGE
LDLVDGMTLMHAFSGRRLVSHE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaactttcagatagtttaacatcgcttattgaagcacttcgttgtcagcccggcatc
ggtccgaagtctgcccagcgtattgcatttcatttattagagcgcgaccgtaaaggcggc
actcagcttggcaatgcgctaacaaaagcgatgacggctgtagggcattgtcagtcgtgc
cgcacgtttaccgagcaagcacaatgtgatatttgcttaagcactaagcgccaagacagt
ggtattttatgtgttgttgaatcgccaacggatgtactcgccattgagcaaacaggtcaa
tacaaagggctttactttgtattaatggggcatttatcaccgattgatggcatagggcct
aaagaaattggccttgatgtactcgagcaaaagcttgcgcaaggcggtattaatgaagtc
attttagccacaaatccttcggttgaaggcgaaacaacggcgcattatattgctcagctt
tgccacaaaaacaatgtgggtgcatcgcgtattgctcatggtattcctgttggtggtgag
cttgatttagtcgatggaatgacgcttatgcatgcatttagcggtaggcgcttagtcagc
catgaatag

DBGET integrated database retrieval system