KEGG   Pseudoalteromonas sp. SM9913: PSM_A2172Help
Entry
PSM_A2172         CDS       T01374                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSM_A2172 (tpiA)
   01230 Biosynthesis of amino acids
    PSM_A2172 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A2172 (tpiA)
   00051 Fructose and mannose metabolism
    PSM_A2172 (tpiA)
   00562 Inositol phosphate metabolism
    PSM_A2172 (tpiA)
Enzymes [BR:psm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSM_A2172 (tpiA)
Exosome [BR:psm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSM_A2172 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSM_A2172 (tpiA)
  Exosomal proteins of melanoma cells
   PSM_A2172 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2330169..2330918)
Genome map
AA seq 249 aa AA seqDB search
MAARKAMVAGNWKMNGSLELVQQLSDAINDVKSSEVNIVLFPPFPLVPAMIASGVTTGTQ
TVSENTPGAFTGEVDAELIKQLGAKYVLVGHSERRSIYKESNDTVAAKFARAQQVGLTPI
LCVGESETEQESGQTEQVVAAQIDAVINKLGVAALKESVIAYEPVWAIGTGKTASPEQAQ
SVHKFIRDKIAALDSDLAQGLTILYGGSVNEKNSELLFAQTDIDGGLIGGASLKAESFTA
ICNSAKGTV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacgcaaagcgatggtcgcaggcaactggaaaatgaatggttcattagaactc
gttcaacaactgtctgatgctattaacgatgttaaatcttctgaagtaaacattgtttta
tttcctccgtttcctctagtcccagcaatgattgcaagtggtgtaacaacaggcacgcaa
acagtgtctgaaaataccccaggtgcgtttactggtgaagtagatgcagagctaattaag
cagctaggtgcgaaatatgtactggttggtcactctgaacgacgcagcatatacaaagaa
agcaatgataccgttgctgcaaaatttgctcgcgcgcaacaagtaggtctaacgcctatt
ttatgtgttggcgaaagcgaaacagagcaagaaagcggtcaaacagaacaagtagttgct
gcgcagattgacgcagtaattaataaattaggtgtagcagcactaaaagaatctgtgata
gcatatgagcccgtttgggctataggcacaggtaagactgcatcgcctgaacaggcacaa
agtgttcacaaatttatccgtgacaaaattgctgcactagatagcgatttagcacaaggg
ctaaccatcttatatggtggtagcgttaatgaaaaaaatagcgaattattatttgcgcaa
acagatatagacggcggcctaattggaggcgcaagtttaaaagcagaatcatttactgct
atctgcaatagtgcaaaagggaccgtataa

DBGET integrated database retrieval system