KEGG   Pseudoalteromonas sp. SM9913: PSM_A2174Help
Entry
PSM_A2174         CDS       T01374                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2332341..2333186)
Genome map
AA seq 281 aa AA seqDB search
MNNKINLARGRTLDFAEPVIMGIVNVTPDSFSDGGQFLNTTAALSHAMQLLDDGATILDI
GGESTRPGAPDVSLEDELKRVIPIIKAIREQSDCVISIDTSKAEVMRQAIEAGADIVNDV
RALQEPGAIDVVAQFPEVAVCLMHMQGQPRSMQHAPHYNDLAGEINDFFSQRIAACEAAG
IKQSQLILDPGFGFGKTLKHNYQILAQFNDYAKLGLPLLAGLSRKSMIGKLLNRDTDDRL
AGSLAGALIAAQNGAHIIRVHDVKETADVLGVYQACKQGVL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaattaaccttgcgcgtggccgaacgcttgattttgcagagcctgtgatt
atggggatcgtgaatgttacccctgattcattttctgatggcggtcagttcttaaataca
actgccgcgctgagtcatgcgatgcaattacttgatgatggtgcgaccattttagatatc
ggtggcgagtcaacacgcccaggcgcacctgatgttagccttgaagatgagctaaagcgt
gttattcctattattaaagctattcgtgagcaaagtgactgcgttatttcaatcgatacc
agtaaagctgaggtgatgcgccaagcgattgaagccggtgctgatattgtcaacgatgta
cgggcattgcaagagcccggcgcaatcgatgtggttgcacagtttcctgaggtagcagtg
tgtttaatgcatatgcaagggcaacctcgtagtatgcaacacgctcctcactataatgac
ttagcgggtgagataaacgatttttttagccagcgaatagccgcatgtgaagctgctggc
attaaacaaagccagttaattttagatcctggttttggttttggaaaaacactaaagcat
aattatcaaatattggctcaatttaacgattatgcaaaattgggacttcctttgctcgcg
ggattatcgcgtaagtcaatgattggtaaattattaaatagagacacagacgatagattg
gcaggcagtttagctggagcactgatcgccgcacaaaacggtgcacacattattcgtgtg
catgatgtaaaagaaaccgcagatgtgcttggcgtatatcaagcctgcaaacaaggagta
ctttaa

DBGET integrated database retrieval system