KEGG   Pseudoalteromonas sp. SM9913: PSM_A2196Help
Entry
PSM_A2196         CDS       T01374                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2351042..2352088)
Genome map
AA seq 348 aa AA seqDB search
MDNTVSLAHSAQCLKKAIPLMVKYKMPVTPINYAIWYCYVQGDNPQLNTELDKVISLHNT
CSAQTAQEIFNKHINDEELAFFQQMSERFHGTVEQMQFDLSDSIQYSKSFTTSLVDSQNE
LKTLSSINSFNEILSCVERLTDESIAMQDYARGFQTKLAQAYNEIKDLKEALSVTQEAVD
KDSLTGLFNRGKFDTDIVEFCLNASSQNEHGKLAVLIMFDIDHFKRFNDDFGHQKGDEVL
KLVAQKVQNSVQEQYRAYRFGGEEFCITGYFESINDAMAFCNQLRLSIAKLTIRKKEDSN
NKRNISASFGIALMEPFSKSCLLVEKADRALYLAKTHGRNRVEIAADM
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggataatacggtttcacttgctcattctgcccagtgtttaaaaaaagccattccgttg
atggttaaatacaaaatgcctgtaacgccaataaattatgctatttggtactgttatgta
cagggcgacaacccacaactaaacacagagcttgataaagtcatctctttgcacaatacg
tgttcagctcaaaccgcccaagaaatttttaataagcatattaatgacgaagagcttgca
ttttttcaacaaatgtctgaaaggtttcatggcaccgtagagcaaatgcagtttgatctt
agtgactccattcaatattcgaaaagctttactacctcgttagttgattcacaaaatgaa
ttaaaaacgctctctagtattaactcatttaatgagatcctttcttgcgttgagcgccta
actgacgaatcaattgcgatgcaagattacgcccgtggattccaaaccaaattagcgcaa
gcgtacaacgaaattaaagatttaaaagaagcgcttagcgtgacccaagaagcggttgat
aaagattccttaaccggattatttaatcgcggtaagtttgatacagacattgttgagttt
tgtttgaacgcctcttcacaaaatgaacacggtaaattagcggtgttgattatgttcgat
attgatcattttaaacgttttaatgacgattttggccatcaaaaaggcgatgaggtactc
aagctagtcgctcaaaaagtgcaaaatagtgtacaagagcaatacagagcttatcgtttt
ggtggtgaagaattttgtattacgggttactttgaaagcattaatgatgcgatggcattt
tgtaatcagcttcgtttgagcattgccaaattgacgattcgtaaaaaagaagacagtaat
aataaacgtaatatttcagccagtttcggcattgctttaatggagccttttagtaaaagc
tgtttattagttgaaaaggcagatagagcactttatttagctaaaacccatggtcgtaat
cgggtcgaaatagcggccgatatgtaa

DBGET integrated database retrieval system