KEGG   Pseudoalteromonas sp. SM9913: PSM_A2235Help
Entry
PSM_A2235         CDS       T01374                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSM_A2235 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSM_A2235 (cheB)
Enzymes [BR:psm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSM_A2235 (cheB)
Two-component system [BR:psm02022]
 CheA family
  CheA-CheYBV
   PSM_A2235 (cheB)
Bacterial motility proteins [BR:psm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSM_A2235 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2387182..2388333)
Genome map
AA seq 383 aa AA seqDB search
MAVKVLVVDDSSFFRRRVSEILEQDSGIEVIGFAVNGREAVEKTAQLRPDVITMDVEMPV
LDGISAVKEIMASNPTPILMFSSLTRAGASATLDALDAGAMDFLPKKFEDIARNNDDAIK
LLQNKVKEIGRQRIGRITRTAPSPSISKPASNSSERFSNLAKKPIVQPDRSFNNASPAPT
SSSASARASGKQYQLVAIGTSTGGPVALQTILTQLPANFPHPILLIQHMPAAFTPAFATR
LDGLCKIKVKEAQQGDRLQPGCAYLAPGGQQMMVEGRGSNRTLRVFEDKNERVNYKPSVD
ITFASAAKAYQGDVLAIILTGMGADGRDGARMLKQTGATIWAQDEKSCVVYGMPQAIASA
GLASESISLHDVAARLKREVGCG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaagttttagtagttgatgattcaagcttttttcgccgcagagtgagtgaa
attcttgaacaagacagcggcattgaggtaataggctttgctgtaaatggccgagaggcc
gtcgaaaaaacagctcagttacgtcctgatgttatcaccatggatgttgaaatgccggtg
ctggatggtattagtgctgtgaaagagatcatggcgagtaatccaacacctattttaatg
ttttcatcgttaacacgagcaggggcatctgccactttggatgcgcttgatgctggggcg
atggactttttacctaaaaagtttgaagatattgctcgcaataacgatgatgcaattaag
ttattgcaaaataaggttaaggaaataggccgccagcgtattggaagaattacgagaacg
gccccatctccaagtattagtaaaccagcgtcaaacagctctgagcgcttttctaacctt
gctaaaaagccgatagttcaacctgatcgtagctttaataatgcgagtcctgcacctact
agcagcagtgcctcagcgcgtgccagtggtaagcagtatcagttagttgctattggtaca
tccacaggtgggccggttgcactgcaaactattttgacgcaattacctgctaattttcca
caccctattttacttatacagcatatgcctgctgcatttaccccggcctttgctactcgc
ttagatggcttgtgtaagattaaggtaaaagaagcgcagcaaggcgatagattgcaacct
gggtgcgcttatttagcgccaggtggccagcaaatgatggtagaaggacgtggctctaat
agaacccttcgtgtgtttgaagataaaaatgaacgagtaaactataaaccaagtgttgat
attacctttgccagtgcggccaaagcgtatcaaggtgatgtgcttgccattattttgaca
ggcatgggtgcagatggtcgtgatggtgctcgcatgcttaagcaaactggcgctacaatt
tgggctcaggatgaaaaaagctgtgttgtctatggtatgcctcaggctatagccagtgca
ggtttagcgagcgaaagcattagccttcatgatgtggctgcacgtttaaaaagagaggtt
ggctgtggataa

DBGET integrated database retrieval system