KEGG   Pseudoalteromonas sp. SM9913: PSM_A2317Help
Entry
PSM_A2317         CDS       T01374                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSM_A2317 (galU)
   00052 Galactose metabolism
    PSM_A2317 (galU)
   00500 Starch and sucrose metabolism
    PSM_A2317 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_A2317 (galU)
Enzymes [BR:psm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSM_A2317 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2466644..2467522)
Genome map
AA seq 292 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLPVVDRPLIQYVVSEAVAAGIKEIVLVTHSSKNSI
ENHFDTSFELEATLEKRVKRQLLAEIQSICPKDVTIIHVRQGEAKGLGHAINCAAPIIGN
EPFVVILPDVIIDDVESDLTKDNLAEMITRFEQTKHSQIMVEPVPKDDVDKFGVVDLGDV
ELNQGESSPIQSMVEKPPVDEAPSNLAVVGRYVLSKNIWPLLAKTPQGAGDEIQLTDAIA
MLMQDEKVDAYAMKGRSHDCGSKIGYLKATIEFALRRDEFAGELKTFIKTLI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgatccccgtagccggccttggaacacgtatgttaccggcaactaaagca
attccaaaagaaatgctgcccgttgtagaccgtccactcattcaatacgttgttagcgaa
gcggttgccgctggtattaaagagatagtgctagtaacgcattcgagtaaaaactcgatt
gaaaaccattttgataccagctttgaactagaggcaacattagagaaacgtgtaaagcgg
caattacttgccgaaatacagtctatttgccctaaagatgtgaccattattcatgtacgt
caaggtgaagcaaaaggcctaggccatgctattaactgtgccgcccctattattggcaat
gaaccttttgtggttattttacccgacgttattattgatgatgtagaaagtgacctaaca
aaagacaacttagctgaaatgattactcgctttgagcaaactaaacacagtcaaattatg
gttgagccagtccctaaagatgacgtagataaatttggtgttgtggatttaggtgatgtt
gagttaaaccaaggtgaaagctcacccattcaaagcatggtagaaaaaccacccgttgac
gaggcaccttcaaaccttgctgtggttggtcgttacgtgttgagtaaaaatatttggcca
ttactggctaaaacccctcaaggtgctggtgatgaaattcagctaacagatgcaatagcc
atgcttatgcaagatgaaaaagtagatgcctacgcaatgaaaggccgaagccatgattgt
ggcagtaaaattggttatttaaaagcaaccattgaatttgctcttcgtcgtgatgaattc
gccggtgagcttaaaacgtttattaaaacgttaatttaa

DBGET integrated database retrieval system