KEGG   Pseudoalteromonas sp. SM9913: PSM_A2373Help
Entry
PSM_A2373         CDS       T01374                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase type II (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
Enzymes [BR:psm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSM_A2373 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2528131..2528769)
Genome map
AA seq 212 aa AA seqDB search
MLANYTRSAQALSDLLQRDGVEDKEVLKAIAQIPRHIFIDDVLKHKAYQNTALPIGQGQT
ISQPYIVARMTELMRLAGVQHKVLEIGTGSGYQTAVLAKTFDKVYSVERIKALQWQAKRR
LHQLDLYNVTMKHGDGWQGWQSQAPFNGIIVTAAATIIPPELLAQLADGGVLLAPIGEVE
QKLTMVIRQGDSFTEHVIAPVRFVPLVPGDIE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctaattatacccgcagtgcacaagcgctttcagacttattacagcgagatggc
gtagaagataaagaggttttaaaagcaatagcgcaaattcctcggcatatttttattgat
gatgtactcaaacacaaggcgtatcaaaataccgcgctacctataggacaagggcaaact
atttctcagccctatattgttgcgcgcatgaccgagctaatgcgactagccggtgtgcaa
cataaggtgttagaaataggcaccgggtcgggctatcaaaccgcggtactggctaaaacc
tttgataaggtgtattcggttgagcgtataaaagctttgcaatggcaagcaaagcgtcga
ttacatcagctcgatttatataatgtcactatgaaacacggtgatggttggcaaggatgg
caatcgcaagcgccatttaatggcattattgtaacggctgcggcaacgattatccctcca
gaactactcgcacaacttgcagatggaggcgtattacttgcccccattggtgaggtagaa
caaaaattaaccatggttattcgccaaggcgatagctttacagagcatgtaattgcgcca
gtaagatttgtacctttggtccctggcgatattgaatag

DBGET integrated database retrieval system