KEGG   Pseudoalteromonas sp. SM9913: PSM_A2530Help
Entry
PSM_A2530         CDS       T01374                                 

Gene name
dsbC
Definition
disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2703623..2704351)
Genome map
AA seq 242 aa AA seqDB search
MKKLMLAGAMLCTSLSAFANSVAVTPDATDPIVTKFAALGVTVKQINPSPVAGLKELITN
KGVLYASPDGQFLMQGTLIDLNNRSNLTEQALNGVRQSGLKEYEDSMIVYKAPEEKHSIT
VFTDISCGYCRKLHRELDDLLESGITVKYLAFPRGGLQGSGYADLMNVWCAKDQQEALTE
AKSGADTQIVKGCSAPVAEHYQLGQSFGISGTPAIILEDGTMIPGYQPAAALSAALEANK
AG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatgttagcaggtgccatgttgtgcactagtttgagcgcttttgctaat
agcgttgcagtcactccggatgctacagatcctatcgtgacaaaatttgccgcgctaggg
gtgaccgttaaacaaattaatccaagcccagttgcaggcttaaaagaattgatcaccaat
aaaggtgtgttgtatgcaagccctgacggtcagtttttaatgcaaggtacgctaatcgat
ctaaacaaccgtagtaacttaaccgagcaagcacttaatggtgtgcgccaatcagggtta
aaagaatacgaagactcaatgattgtgtataaagcgccagaagaaaaacacagcattact
gtatttaccgatattagctgtggttactgtcgtaaattacaccgtgaactagatgactta
cttgaatcgggcattacggttaaatacctagcgtttccacgcggtggcctacaagggtca
ggttatgctgatttaatgaatgtatggtgtgcgaaagatcagcaagaagcacttactgaa
gctaaatctggtgcagatacccaaattgttaaaggctgtagcgcacctgttgctgagcat
tatcagttaggccagagttttggtattagcggtacaccggctattattttagaagatggc
acgatgatcccaggctaccaaccagctgcggcattaagcgcagcgcttgaggctaacaaa
gcgggctaa

DBGET integrated database retrieval system