KEGG   Pseudoalteromonas sp. SM9913: PSM_A2718Help
Entry
PSM_A2718         CDS       T01374                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:psm00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2899696..2900640
Genome map
AA seq 314 aa AA seqDB search
MFYSNESELENNLPAINEFYTNTLKKAYLSTAAGKLFYAYAKPKQAHTAIVISSGRIEGL
DKYKELLWELYCNNFAVFIVDHQGQGRSYRLLKNPHKGYVKQFEDYSYDLNQFNLEVVKQ
HWQGKKLLLSHSMGGAIAFDYLARYSHDFSGAFLSAPMFDIHTKGIPKPVAQFIAASASL
LGFSGCYALGQSDYTPEEFALNTLTSSQIRYDQFRATYQQTPLLQLGGVTYGWLHTVFSF
IKALDKLSITTPLFIASAENDEVVDNQAQHKLASRHKNTLIKQFKGAKHELFFERDEIRQ
PLLTSLYKFCDSIG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttttatagcaatgaaagcgagcttgaaaataacctgcctgccattaatgagttttat
actaatacactcaaaaaagcctatttaagcacggctgccggtaaattattttatgcttac
gctaagcctaaacaggctcacactgccattgttattagttctgggcgcattgaaggactc
gataaatacaaagagctgctttgggagctttattgtaataattttgctgtttttattgtt
gatcaccaaggccaaggacgctcttatcggttattaaaaaacccccataaaggctatgtc
aaacaatttgaagattacagttacgatctcaatcaattcaatcttgaggtggtaaagcag
cattggcaaggtaaaaaactactgcttagccattcaatgggcggcgctattgcgtttgat
tacttagcacgttactcacatgactttagtggggcgtttttatctgcgcccatgtttgat
attcatactaaaggaataccaaaacccgtagcacagtttatcgctgccagtgcgtcatta
ttagggttctcagggtgttatgcgttaggacaaagcgattatacacctgaagagtttgcg
cttaacactttaaccagtagccaaatacgctatgatcaatttagggcaacttatcagcaa
acgccactattacaattaggcggtgttacctatggctggctgcatactgttttttcattt
attaaagcgctcgataaactatccataacaaccccgttatttatagccagcgcagaaaat
gacgaagtggttgataaccaagcccagcataagcttgcaagccgacataaaaacacccta
ataaagcagtttaaaggggctaagcacgagctgttttttgagcgggacgaaattcgccaa
ccattgctaacaagcctttataaattttgtgattcaataggttaa

DBGET integrated database retrieval system