KEGG   Pseudoalteromonas sp. SM9913: PSM_A2989Help
Entry
PSM_A2989         CDS       T01374                                 

Definition
long chain acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PSM_A2989
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSM_A2989
Enzymes [BR:psm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PSM_A2989
Lipid biosynthesis proteins [BR:psm01004]
 Desaturase
  First
   PSM_A2989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3177889..3179022
Genome map
AA seq 377 aa AA seqDB search
MKKPPLIWTNVLFFSLTFLAAVTLVPWYGFNYGFTGTQWAAFVACMFFAGLSITAGYHRL
WAHKTYNAHPVVEFIFALGGAFALQNSALHWSSDHRIHHGQVDDPVKDPYAATNGFWYSH
IGWMLRDYQGDSYGDYSNCRDLQRNKIVMWQHKHYLKLVVAMNVGLPLVLGLMLGDVWGM
LLLTGLLRLVLSQHFTFFINSVAHIWGSRPYTEKNTARDNGFLALFTYGEGYHNFHHIFA
SDYRNGIKWFHYDPTKWMIRSLAALGLASKLKRTPVERIEKAKAETLMSKTQGRLAKLPL
AQDKLTLLQQEYDLLLKKLQNYCSLQKQVLEAKKNNMAKQCEKSALMAQYHELEAAWETQ
KQAWLALNARLLKASFS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccaccacttatatggaccaacgtcctgttctttagcctgacgtttttggct
gctgttacacttgtaccttggtatgggtttaactatggctttacaggcacacaatgggct
gcttttgtagcttgcatgttttttgctggattatcgatcactgcgggttaccatcgttta
tgggcgcacaaaacctacaacgcacacccggtcgttgaatttatttttgccttaggcggc
gcgtttgctttgcaaaacagtgcgctgcattggagcagcgatcatcgtattcaccacggt
caagttgatgaccctgtaaaagacccttatgccgctaccaacggcttttggtatagtcac
ataggctggatgctgcgcgactaccaaggcgatagctacggtgattacagcaattgccgc
gacctacaacgcaataaaatagtgatgtggcaacataaacattacttaaagctggtagtt
gccatgaatgttggtttaccactggtattaggtttaatgttaggtgatgtgtggggcatg
ttattactaacgggactacttcgtttagtactgagccagcattttaccttttttattaac
tctgttgcgcacatttggggttctcgcccttacacagaaaaaaataccgcacgcgataac
ggctttttagccttatttacttatggcgagggttatcataactttcatcatatttttgct
agcgattaccgcaacggcattaagtggtttcattacgacccaactaaatggatgatccgc
tcgttagctgcacttggtttagcgagtaaattaaagcgcacaccggttgagcgcatagaa
aaagctaaagcagaaaccttgatgagcaaaacacaaggtcgcctcgcaaaattgccttta
gcgcaagataagcttacattattacaacaagagtacgatttgttgcttaaaaaactgcaa
aattattgctcattacaaaaacaagtgttggaagctaaaaaaaataatatggcaaagcag
tgtgaaaagtcggcattaatggcacaatatcacgagcttgaggccgcctgggaaacacaa
aaacaggcatggctagcacttaatgcgaggttattaaaagcctcttttagttaa

DBGET integrated database retrieval system