KEGG   Pseudoalteromonas sp. SM9913: PSM_A3024Help
Entry
PSM_A3024         CDS       T01374                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3210347..3210889
Genome map
AA seq 180 aa AA seqDB search
MSQLTIFADSDANNALLTSSDVQNIAAELAKVNVRFEQWQANTEITESTSNNDILTAYSG
DIERLKQQGGYQTVDVISLAKGDPDASELRKKFLFEHTHSEDEVRFFVKGQGLFCLHIGS
KVYQVLCQQGDLISVPKLTPHWFDMGSDPEFTAIRLFNNTQGWVAQSTESPIAEQFPLLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcactatttttgcagattctgacgccaataatgcactgctgaccagtagc
gacgttcaaaatattgccgctgaacttgctaaggttaatgtgcgttttgagcaatggcag
gcaaataccgagatcactgaaagcaccagcaataatgatattttaactgcctacagcggc
gatattgaacgcttaaaacagcaaggcggctatcaaactgttgacgttatatcactagct
aaaggcgaccctgatgcttcagaattgcgcaaaaagtttttatttgaacacactcacagc
gaagacgaagtgcgcttttttgtcaaaggccaagggttattttgcttacacattggcagt
aaagtgtaccaagtactttgccaacaaggcgatttgatctcagtacctaagctgacccct
cattggtttgatatgggcagcgacccagaatttaccgctattcgtctatttaacaataca
caaggttgggtagcacaaagcacggaatcaccgattgcagagcaatttccattattaccg
taa

DBGET integrated database retrieval system