KEGG   Pseudoalteromonas sp. SM9913: PSM_A3073Help
Entry
PSM_A3073         CDS       T01374                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
psm00010  Glycolysis / Gluconeogenesis
psm01100  Metabolic pathways
psm01110  Biosynthesis of secondary metabolites
psm01120  Microbial metabolism in diverse environments
psm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSM_A3073
Enzymes [BR:psm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSM_A3073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADT69986
Position
I:complement(3271229..3272083)
Genome map
AA seq 284 aa AA seqDB search
MQLSPSVCIERTHSGLEFISINSRQCKAKIFLQGGQITEFTPKGKLSLLWVSGDETFSEG
KGIRGGIPICWPWFGQHENKDFPAHGFARTHVWQADEVHETENEITVSLKLPMKQIDSTF
WPHQSSLRVEFILSEQLEVRLTTFNLGNTPFSYTQALHSYFPTDDINNTRVTGLQGAQYI
EFGQGPYQQSDVVGFTRETDMVYTQAAAVQTIETPQGMISVSRENSRSCVLWNPWIEKSK
RLSNFADDDYKSMLCLEAANVLEDAVSLEPKQSHTLVTTIKWLG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcaattatcaccctcagtatgtattgagcgtacacatagcggtttggaatttattagt
attaatagtcgccaatgtaaggcgaagatatttttacaaggtgggcaaataactgagttt
acacccaaaggaaaattgtcactattgtgggtgtctggggatgaaacctttagcgaaggg
aagggcattcgtggtggtattcctatttgctggccttggtttggtcaacatgaaaataaa
gactttccagcacatggttttgcgcgcacgcacgtatggcaagccgatgaagtgcatgaa
accgagaacgagattactgttagtcttaaattaccaatgaagcagatagattctaccttt
tggcctcatcaatcttctttaagggttgagtttattttatctgagcagttagaggtgcgt
ttaaccacctttaatttaggtaacaccccatttagttatacacaggcgctgcattcttac
tttccaactgatgatattaataatactcgcgtaacagggctgcaaggggcgcaatacata
gaatttggccaagggccttatcagcaaagtgatgtggttggttttacccgtgaaaccgat
atggtttatacccaagccgccgctgtgcaaactattgaaactcctcaagggatgatcagc
gttagcagagaaaactcgcgctcgtgcgtgttatggaatccatggattgaaaaatcaaag
cgactatcaaattttgccgatgatgattataaaagcatgttatgcctagaggctgcgaat
gtacttgaagatgcggtttcgcttgagccaaaacaaagtcataccctagtaacaacaatt
aagtggcttggctaa

DBGET integrated database retrieval system