KEGG   Pseudoalteromonas sp. SM9913: PSM_B0063Help
Entry
PSM_B0063         CDS       T01374                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSM_B0063 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSM_B0063 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSM_B0063 (glcB)
Enzymes [BR:psm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSM_B0063 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(67185..69362)
Genome map
AA seq 725 aa AA seqDB search
MSHTLTHSGLSVDKQLAEFVKKQLLPGTHLDEHQFWKSFANIVQTLTPLNKSLLAKREQL
QKQIDDYHLANKNADQAQYQAFLKDIGYLVDEPENFSIETQNVEPEIALTAGPQLVVPVS
NARFALNAANARWGSLYDALYGTDVLSEDDGAEKGSQYNPVRGFKVMAYARQFLDKALPL
ENGSHIESTNYSIVDGALAITLRDSSHTTLKNPEQLIGYQGEAQNPSVILLKNNGLHIEL
QIDHHHPIGQADKAGLKDVELEAALTTIMDCEDSVAAVDAEDKVQVYKNWLGLMQGNLVE
TFRKGDKMVDRTLQADRQYTGLDGQKLSLKGRSMMFVRNVGHLMTNPAITDVSGNDVFEG
IMDAMFTATAALHDLNTKNTIKNSTAQSINIVKPKMHGPDEVAFANTLFGMVEEALSLPK
NTLKMGIMDEERRTSANLKACIHAAKARVVFINTGFLDRTGDEIHTSMQAGVVLPKAAIK
AQPWISAYEDRNVDIGLACGLSHKAQIGKGMWAMPDKMAMMMEQKIAHPQSGANTAWVPS
PTAATLHAMHYHDVDVFSLQQSIATRQIASLESLLTPPLMPNPETLSKEDIQSELENNAQ
GILGYVVRWIDQGIGCSKVPDINHIGLMEDRATLRISSQHIANWLHHGVCSKEQVQKVMA
KMAKVVDGQNEHDSLYTPMATNEQTLAKSIAYQAALALVFEGVSQPSGYTEPLLHSYRLK
YKAQH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagccacactctcacccattcaggactcagcgttgataagcaacttgctgaatttgtt
aaaaaacaattattacctggtacccatcttgatgaacaccagttttggaaaagctttgcc
aacatagtgcaaacacttacaccattgaacaagtcactactggctaagcgtgaacagcta
caaaagcaaattgatgactaccaccttgcaaataaaaatgctgaccaagctcagtatcaa
gcgtttttaaaagatattggctacctagttgatgagcctgaaaactttagtattgaaact
caaaatgtagagccagaaatagcgctgactgcagggccacaactagtggtgccggttagt
aatgcacgctttgcgcttaatgcagctaatgcacgttgggggtcgttgtacgatgcttta
tatggaaccgatgtattaagcgaagacgacggcgccgaaaaaggcagccaatacaaccct
gttcgaggctttaaagtaatggcttacgcaaggcagtttttagacaaagcattaccgctt
gaaaatggctcgcacattgaaagtacaaattattctattgttgacggcgcccttgctatt
accctgcgcgacagttcgcacaccacacttaaaaaccctgagcaactgattggctatcaa
ggtgaagcacaaaacccgagtgttattttacttaaaaacaatggattgcatattgagctg
caaatagaccatcaccaccctattggtcaagctgataaagcagggttaaaagatgtggag
ctagaagccgcactaacaaccattatggactgtgaagactcggttgccgcagtggatgca
gaagataaagtacaagtttacaaaaactggcttggtttaatgcaaggcaacttggttgaa
acgtttagaaaaggcgacaaaatggtcgaccgcacgttacaagctgaccgacaatataca
ggtcttgatggccaaaaactgtccctcaaagggcgcagtatgatgtttgtgcgtaacgtg
ggacatttaatgacaaatccagccattaccgatgtaagcggcaatgatgtgtttgaaggc
attatggatgccatgttcaccgcaacagctgctttgcacgatttaaacactaaaaacacg
attaaaaattcaaccgcgcaaagtattaatattgtaaaaccgaaaatgcatggccctgat
gaagtcgcctttgctaatactttatttggtatggttgaagaggcactgagcttgcctaaa
aacacccttaaaatgggtattatggatgaagaacgtcgaacatcagccaacttaaaagca
tgtattcatgcagcaaaagcgcgtgttgtgtttattaacactggctttttagaccgcact
ggcgatgaaattcatacctcaatgcaagcgggtgttgtgctgccgaaagcggctattaaa
gcacagccttggatcagcgcttacgaagatcgcaacgttgatattggcctagcctgtggc
ttaagccataaagcgcaaattggtaaaggtatgtgggcaatgccagataaaatggcgatg
atgatggagcaaaaaatagcgcaccctcaatctggcgcaaataccgcttgggtgccctcc
cctactgccgccacattacacgcaatgcattatcatgatgttgatgtatttagcctgcag
caaagcattgccacgcgtcaaatagcaagcctagagagcttacttacaccgccgctcatg
ccaaaccctgaaacgctatcaaaagaagatattcaaagcgagcttgaaaacaacgcgcaa
ggtattttaggctacgtagtacgttggattgaccaaggaataggctgctctaaagtgcct
gacattaatcatattggtttaatggaagacagagccaccttacgtatttcaagccaacat
atcgccaactggctacatcatggtgtatgtagcaaagagcaagtacaaaaagtgatggca
aagatggctaaggttgttgatggccaaaacgagcatgacagcctttacacgccaatggca
actaatgagcagacattagctaaaagtattgcgtatcaagctgctttagcactggtattt
gaaggggttagtcaaccgagcggttacacagagccgctactacacagctaccgcttgaaa
tataaagcacagcactaa

DBGET integrated database retrieval system