KEGG   Pseudoalteromonas sp. SM9913: PSM_B0131Help
Entry
PSM_B0131         CDS       T01374                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSM_B0131
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSM_B0131
Enzymes [BR:psm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSM_B0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:145209..147899
Genome map
AA seq 896 aa AA seqDB search
MKIKSLLTACCLALGLSACQGNVDEQNTVSVQLSPANDSAVELLAKTLQIKYQQVDNRPS
AQCDPDIENGHCFKAYLHLTANSAINFDQWKIYFSQITPIQTAVSDEFTIKRVNGDIHVI
ELKDGFTGFKAGETKTITFYAHFWSLSQSDAIPNYIVVNNNDTAKVIESTKPKIDPETGL
EVLPHVMPYTDYERQFKRTANDKTQWLSAERLFERNEKYDFSAYLTSQNQVSNVIAQQII
PSPRFSEFSQTQTLDISQGLNINYSGIDKTHLSAATQRLALLGINISDDAAAIKVTLNTV
TKNDEFEGSYKLAIKADEIVINAADEAGIFYALQSLASLYQVNSNMLPVGEVIDAPHYQF
RGVLVDVARNFRDKGFILKLLDQMAAYKLNKLHLHLSDDEGWRIEIPSLPELTDIGAKRC
FDQSEQQCLMPQLGAGLDTSSAANGYYSVADYQEILKAASARHIQVIPSLDMPGHSRAAI
KAMQARYNKYIKQGDKQKAEQFLLYDPLDTTVYSSVQHYNDNTINVCLDSSYAFIREVME
QVKGIHSDAQHPLTRYHIGADETAGAWVDSPACADFIKQNKLEITEASQLGSYFIERIAN
MLADMNIETAAWSDGLSHTNPENMPEVVQGNSWDLLMWNGHQRAHEFANRNWQVVLSSPD
VLYFDFPYEADPQEHGYYWASRHINTEKIFQFMPDNLPIHAEFWLDREDKPYVADDTLKH
DEQGKVVSAPLAKDKRFIGIQGQLWSENTRTNNMAEYKLFPRLLSLAQRAWHKADWAVPY
DHNGFVYSQQTNRFSSALKQQRDQQWQTFAATMGLKEFPKLEMADVHYRLANAGAKIENG
MLYANIAYPGLVIEYKQGSGQWQTYKQPVKVTQDVWIRSKTPSASRVSRKLKVTHR
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaatcattactgacagcatgctgcttagcactgggtttgagtgcgtgtcag
ggcaatgttgatgaacaaaatacggtatcggttcagctaagccctgcaaacgatagcgcc
gtagagttacttgctaaaaccttacaaataaaatatcagcaggttgataaccgtccatca
gcacagtgcgatccagatatagaaaacggtcactgttttaaagcgtatttacatttaacc
gccaactcggcgattaactttgaccaatggaaaatttactttagtcaaattacacctatt
caaacggcggttagcgatgaatttactattaaacgtgttaatggcgatattcatgtcatt
gagcttaaagacgggtttactggctttaaagcgggtgagactaaaacgattactttttat
gcgcacttttggtcattatcgcaaagcgacgcaattcctaattatatagttgttaataat
aatgacaccgctaaagtgattgaaagcacaaaacctaaaattgacccagagacagggtta
gaggtgttgccacatgttatgccttacaccgattatgaacgtcagtttaaacgtaccgcg
aatgataaaacgcagtggcttagcgctgagcgcttgtttgagcgcaatgaaaaatatgac
ttttctgcttatttaacgtcgcaaaatcaagtgagcaatgtgattgctcaacaaattatt
ccgtccccacgttttagcgaatttagccaaactcaaacgctagatataagccaagggctt
aatattaactactcaggaatagataaaacacacttatctgccgcaacacaaaggttagca
ctactaggtattaatataagcgatgatgcagcggccattaaggtcacacttaatacagta
actaaaaatgatgaatttgaaggcagctataagttagcgattaaagctgatgaaattgtg
attaatgccgctgatgaagcgggcattttttatgctttgcaaagcttagcgagtttgtat
caggttaacagtaatatgttacctgtgggagaagtaattgatgcaccgcattatcagttt
agaggtgtgttggtggatgtagcacggaactttcgcgacaaaggctttattttaaagctg
cttgatcaaatggcggcttataaacttaataagctgcatttacatttaagtgatgatgaa
ggttggcgtatagaaatcccatcacttcctgaacttacggatataggggcgaagcgttgt
tttgatcaaagcgagcaacaatgtttaatgccacagttgggcgcagggcttgatacttca
agtgcagcaaacggctattattcggtggctgattatcaagaaatacttaaagcggcgagt
gcgcgtcatattcaagtgatcccatcacttgatatgccagggcattctcgcgctgcaatt
aaagccatgcaagcgcgttataataaatacataaaacaaggcgataaacaaaaagccgag
cagtttttactttatgatccgcttgatacaaccgtgtattcgtcggtacagcactataac
gacaataccattaatgtgtgtttagactcatcgtatgcgtttattcgtgaagtaatggaa
caggtaaaaggcatacacagtgatgcacagcatccgttaacccgttatcacataggcgcc
gatgaaaccgccggagcgtgggttgactcaccagcttgtgctgattttattaaacaaaat
aagttagaaattactgaagcgagtcagctgggcagctattttattgaacgtattgcgaat
atgttggctgatatgaatattgaaaccgctgcatggagcgatggtttatcgcatactaat
ccagagaatatgccagaggttgtacaaggtaatagctgggatttattaatgtggaacggc
catcaacgtgcccatgaatttgctaatagaaattggcaagtggtactctcgtcgccagat
gtgctgtattttgactttccgtatgaagcagacccacaagagcacggctattactgggct
tcaaggcatataaataccgaaaaaatatttcagtttatgccagataatttacctattcat
gctgaattttggctcgatagagaagataagccttatgtagctgatgacacgttaaagcat
gatgagcaaggcaaggtagtatcagcgcctttggcaaaagataaacgctttattggtatt
caagggcagttatggagtgaaaatacgcgcaccaataatatggccgaatataagctcttc
ccacggttattatcgttggcacaaagagcatggcataaggcagattgggcggttccgtat
gatcacaatggctttgtttatagccaacaaacaaatcgctttagctcagcattaaaacag
cagcgcgatcagcaatggcagacttttgcagccacaatgggattaaaagaatttcctaag
ctagaaatggctgatgtgcattatcgtcttgcaaatgcgggcgcaaaaattgagaacggc
atgttgtacgccaatattgcctaccctggtttggtaattgaatacaaacaaggaagcggc
caatggcaaacctataaacaacccgtcaaagtaacacaagatgtatggattcgctctaag
actccatcagcaagtcgtgtaagcagaaagctcaaagtaacgcaccgataa

DBGET integrated database retrieval system