KEGG   Pseudoalteromonas sp. SM9913: PSM_B0264Help
Entry
PSM_B0264         CDS       T01374                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:297936..299408
Genome map
AA seq 490 aa AA seqDB search
MMKNKVQLITYADRITGRDINALTTLLHGPLEGVFGGVHLLPFYNPIDGSDAGFDPIDHS
EVDSRIGTWDDIKALGKDHDLMADLIVNHVSAQSFQFQDVLAKGKASAFWDLFLTKEDVF
PNGMSEAEQQAIYRPRPGSCFTPMKCGDGQTYDFWTTFTDNQIDINVKVEAGIAYLNNVL
TKFSANNVNIIRLDAAGYAIKQAGTNCFMLDETFGYLDNLSKQANDLGMETIAEIHSHYQ
TQVDVAKRVNMVYDFALPPLILHSLFNNNADALLKWLKISPRNCLTVLDTHDGIGIIDAG
PMGEKPGLLNAEQIDNLVETMHANSNNQSRQATGAAASNVDLYQVNCTYYNALGANDFDY
LLSRAIQFFAPGVPQVYYGGLFACENDMELLAKTNVGRDINRPYLNAAKIEQALNKPVVK
GLIELIKMRNEHPAFAGEFSAQGGASVCCLMWKFEQQSISLRIDFASRIALISQVNGTQE
STLNLQSLLA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaataaagttcaattgatcacatacgctgatcgaattactggccgagatata
aatgcacttaccactcttttacatggcccattagagggcgtttttggtggtgtgcactta
ttgccattttataacccaattgatggcagcgatgcaggctttgacccgattgatcatagt
gaagttgattctcgaatcggtacttgggacgacataaaggcactcggtaaagaccatgat
ttaatggctgatctaatagtgaatcatgtgtcggcgcaatcttttcagtttcaagatgta
ctggctaaaggtaaagcgtcagcattttgggatttatttttaaccaaagaagacgtgttt
cccaatggcatgagcgaggctgagcagcaagctatttaccgtccacgcccaggcagttgt
tttacaccaatgaaatgcggtgatggtcaaacgtatgatttttggaccacttttaccgac
aatcaaattgatataaacgtaaaagtagaggcgggaattgcgtatttaaataatgtactt
actaagttctctgctaacaacgttaatattattcgtttagatgcagcgggttatgccatt
aagcaggcgggtactaattgttttatgctagatgaaacgtttggctacttagataactta
tcaaagcaagccaacgatttaggcatggaaaccattgcagaaattcatagccattatcaa
acacaagtagatgtagctaagcgcgttaatatggtttacgactttgcgttgccaccactt
attctacatagcttgtttaataacaatgcggatgcattactcaaatggctaaaaatatcg
ccgcgtaactgtttaacggtactagacacccatgatggcataggcattattgatgcaggc
ccaatgggtgaaaaaccaggcttattaaatgcagagcaaattgataacctagtagaaacc
atgcatgcaaatagtaacaatcaaagccgccaagcaacaggcgctgctgccagtaatgtc
gatttatatcaagtgaactgtacttattacaatgcattaggcgctaatgattttgactat
ttgctgtcgcgcgcaattcaattttttgcgccaggtgtaccgcaagtttattacggcggc
ttatttgcctgtgaaaacgatatggaactgttagcaaaaaccaatgttggccgtgatata
aatcgcccatatttgaacgcggctaaaatagagcaagcacttaataaaccggtagtaaaa
gggctcatagagctaattaaaatgcgtaatgaacatcccgcatttgcaggtgaattttcg
gctcaaggcggcgcaagtgtttgttgtttaatgtggaagtttgaacaacaatcaatttca
ttgaggattgactttgcaagccgtattgcacttatttcgcaggttaatggcactcaagaa
agcactctaaacttacaaagtttattggcttaa

DBGET integrated database retrieval system