KEGG   Pseudoalteromonas sp. SM9913: PSM_B0392Help
Entry
PSM_B0392         CDS       T01374                                 

Definition
putative manganese binding agmatinase (SpeB) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSM_B0392
Enzymes [BR:psm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PSM_B0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:432233..433342
Genome map
AA seq 369 aa AA seqDB search
MSTQFQAFKNKVEHCLCAPGDGVFTVNTAKERKAALRNKLYGQTENVDALWRDSLNELPN
SPHKAVMLGISSDCGGGILRGANWGPLFLRSALIDQQTQCRSFDLGDVRVIPHLLHDKYL
NEATITNCQKALYGNDNNDHFVSPLSITEDVCDSFYATFQDKGIFGIGGDHSISYPLTKA
YLKAKREQGKRTAIIHFDAHTDLLVERLGIDLCFGSWCTHILEFLPAPHHLIQFGIRSSG
KPKSHWESTFGVKQHWAAEIIERGAAAVAADTIAQLKADKVDEVYVSFDIDALDAQFASA
TGTPEENGLTPQHALDILSAIADEFPITGADMMEIAPFTDSSLVGQSSSETTLREGAKIS
AFLIAAMNR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacaatttcaagcatttaaaaataaagttgaacactgtttatgtgcacctggc
gacggtgtattcacggttaatacggcaaaagaacgcaaagcagcactcagaaataaatta
tatggtcaaactgaaaatgtcgatgctttatggcgtgactcgctaaatgaattacctaac
tcaccccacaaagcggttatgctggggattagctctgattgtggtggtggtattttacgc
ggtgcaaactgggggcctttatttttacgttcagctttaattgaccagcaaacacagtgt
cgttcatttgacttaggtgatgtgcgcgtaataccgcatttattacacgataaatactta
aacgaggcaacaattaccaattgccaaaaagcgctttatggcaatgacaataacgatcat
ttcgtaagtccactgtctattaccgaagatgtatgtgacagcttttatgcaacattccaa
gataaaggcatttttggcattggtggcgatcattctattagttacccgctgacaaaagcg
tatttaaaagccaaacgcgagcaaggtaaacgtacggcaattattcattttgatgctcac
accgacttactcgtagagcgtttgggtatcgatttatgttttggctcttggtgtacccat
attttagaatttttacccgcgccacatcatttaattcaatttggtattcgctcaagtggt
aagcctaaatcacattgggaaagtacctttggcgttaaacagcactgggctgctgaaatt
attgagcgtggcgcagccgctgttgctgccgatacaatcgcgcaactaaaggctgacaag
gttgatgaagtgtatgtaagctttgatattgacgcactagatgctcaatttgcttcagca
acaggtacacctgaagaaaatggattaacaccacagcatgcgcttgatattttgtcagcc
attgccgatgagtttccaataaccggtgcagatatgatggaaatcgcgccgtttaccgac
agctcattagtgggtcaatcaagctcagagacgacgcttagagaaggcgctaaaatttca
gcattcttaattgcagcaatgaatcgttaa

DBGET integrated database retrieval system