KEGG   Pseudoalteromonas sp. SM9913: PSM_B0464Help
Entry
PSM_B0464         CDS       T01374                                 

Definition
putative sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0464
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PSM_B0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:512189..513967
Genome map
AA seq 592 aa AA seqDB search
MNIVKELFFQRVEQHLHAIYQDVELPIAISELTEELITLILGDNPLRDPTPHTNRWDEQD
VVLIAYGDSIINHEDSDLAVGTPLEAPLKTLHRFIKEQCDHQLNALHILPFYPYSSDEGF
AVMNYAHVNEALGDWQDINAIAKDVKLMADLVINHCSSRSIWFENFLTDTHPGKDYFKTA
SLTDDLSQVVRPRTSPLLNTVTTTSGEKHVWCTFSHDQVDFDFENPEVLKEFVGIIRHYL
DNGIRLFRLDAVAFLWKQLNTSCINLPQTHEVVRLLRTLIEHAEPSVVIITETNIPNQEN
LSYFGNANEAHAIYNFALPPLLLHTLLSGDSTALKHWMMSMPPAQNGTAYFNFIASHDGI
GLRPIEGLLQPSEVASLVSTTMQFGGRVSMRTSHDGTHTPYELNIALFDALQGTHNGADK
FGLERFLCAHAIMFAMEGIPGLYIHSLLGTTNDYERFDNSQHNRAINRHRWQESKLLAAI
AEKYSHHHQVFNGVKQLLAVRKRQAAFHPNATQFTLHLGEGLFGFWRQSIDRQQSIFCIY
NISSQPQSLTLADLNLINTQQWYELLSKTVLDEELKTMQLAPYQTLWLSNRA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatagttaaagaacttttttttcaacgagttgaacaacatttacatgctatttat
caagatgttgaattaccgatagcaataagcgaattgactgaagaattgatcaccttaatt
ttaggtgataacccacttcgcgatcccacgccacacactaaccgctgggatgagcaagat
gttgtgctaattgcctatggcgattcgataataaaccatgaagacagtgatttagccgta
ggcacccctttagaggcgcctttaaaaaccttgcatcgctttataaaagagcagtgcgat
catcagcttaatgcactgcacattttacccttttatccgtatagctcagatgaaggattt
gcggtaatgaactatgcacacgttaatgaagcgctgggtgactggcaagacattaacgcg
attgcaaaagatgtaaaactgatggcggatttagtcattaatcattgctctagtcgaagt
atttggtttgaaaactttttaactgatacacaccccggaaaagattactttaaaacagcc
agtttaactgacgatttaagccaagtagttcgtcctcgtacatcgccactattaaatacg
gtaacaacaaccagtggtgaaaaacatgtatggtgcacatttagtcatgatcaagtggat
tttgattttgaaaatcccgaggtgttaaaagagtttgtcggcattattcgtcattattta
gacaacggtattcgcttatttcgccttgatgctgtggcctttttatggaaacaacttaat
accagttgtataaatttaccgcaaacccacgaagtagtacgtttattacgaacgctgatt
gagcatgccgagccaagtgtggtgatcatcaccgagactaatattcccaatcaggagaac
ttgtcttactttggtaatgccaacgaagcccatgcaatttacaactttgccttgccgccg
ttgttgttgcataccttacttagtggcgatagtacggcgcttaagcattggatgatgagt
atgccgcctgcacaaaacggcactgcgtattttaattttattgcttctcacgatggcatt
ggtttaaggccaattgaaggcttgctgcaacccagtgaggttgcttcattagtcagtacc
accatgcagtttggtgggcgcgtttcaatgcgtactagtcacgatggcacacataccccg
tatgagctaaatattgccttgtttgatgccttacaagggacgcataatggcgcggataaa
tttggccttgagcgctttttatgtgctcacgccattatgtttgcaatggaggggatccca
gggctgtatatacatagtttacttggcaccactaatgactatgaacgctttgataattcg
cagcacaatcgcgccattaaccgtcatcgctggcaagagtcaaaattattagcggcaatt
gcagaaaaatatagtcatcatcatcaagtattcaacggagtaaaacagttattagcagtg
cgtaaaaggcaagcggcatttcatcctaatgcaacacagttcactttgcatttaggagag
gggttatttggtttttggcgacaaagcattgaccgccagcaaagtattttttgtatttat
aatatcagcagtcagccacaaagcttaaccttggccgatttgaacttaataaatacacag
caatggtatgagctgctctctaaaacagtgctggatgaagagcttaaaactatgcaatta
gcaccgtatcaaacactctggttatctaatagagcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system