KEGG   Pseudoalteromonas sp. SM9913: PSM_B0509Help
Entry
PSM_B0509         CDS       T01374                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0509
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSM_B0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:555901..557889
Genome map
AA seq 662 aa AA seqDB search
MDALSQLFYLHGIGYEYTKYTGEHVIFSEDTRKSALHCCGVDTRDTAQITQLNYQLDAAT
WLTLAPAVSIIDQASNVLKVRVNEADTHHKITLTVAALNIKLQFEHIAQYAALGEYFVNG
CRYIEIALPLTHLPTGYYDALLTMGEQSAKTQIWSTPKQAYQIADKKRFGLSIQLYTLKN
KAGLGIGDFSDLLELATLCAKQNMDYILLNPLHLLFADNPECASPYNPNNRALLNPLYIA
INLSPDSFNNSDLTKLLSANTSSKYSDQGVAFIDYKTVTECKYAAFKLLFKHFQQQGSQA
RQNEFSAFCKQYSDVLAMLETTEPTFEYYLQWQAHSQLTQCQQHCIAQGMAIGLINDLAV
GCANEGTEFKYQQGLFSQDATLGAPPDPWAPNGQNWGLPAINPQRLADNNYQFYRSLIRA
NMDAVGGLRIDHVMAIRRLWWCFINNNTQDGCYVYYPFEHLLAILKIESHLNQAIVIGED
LGVVPPEVKEALVDSGIFSNSLFYFEKQQNDEFVNSDDLSDQCLLMIANHDVPPFVGWWQ
HSDLKIKQQYGLIDTDEYQQLVQQREQEQHRLLRFLNPQNTSLSLNTDAFDVYSTLAVCL
AKSPSRLFALQLDDLDKQHYPVNIPGTDKEYPNWRRVLTHTCDDIFKDNAALLAAIHSIR
NA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactatcgcaattgttttatttgcatggtattggttacgaatacactaagtat
acgggtgaacacgttatatttagcgaagacacccgtaaatctgctttgcactgctgtggc
gttgacacacgtgatacggcgcaaataacccagttaaattatcaattggatgcggctacg
tggttaacactcgcacctgctgttagcataatagatcaggctagtaatgtgctaaaggtg
cgtgttaatgaagctgatacgcatcacaaaattacattaactgtggcagcattaaatata
aagctgcaatttgaacacattgctcagtatgcagcattaggtgagtactttgtaaatggg
tgtcgttatatagaaatagcgctaccactgacgcatttaccaaccggctattatgatgcg
ttattaacgatgggtgagcaatcagcgaaaacacaaatttggtcgacccctaaacaagcc
taccaaatagcggataaaaaacgctttggcttatcaattcagttatatacattaaaaaat
aaagccggactcgggattggcgattttagtgatttacttgagttggcaaccttatgtgca
aagcaaaatatggactatattttacttaacccattgcacttattgtttgcagataaccct
gagtgcgccagcccctacaacccaaacaatcgtgccttactcaatccgctatatatcgca
attaatttatcgccagacagctttaacaattcggatttaactaagttgttatctgctaat
acctcaagtaaatacagcgaccaaggtgtagcctttattgattataaaacggttactgag
tgtaaatatgctgcttttaagctgctttttaagcattttcaacaacagggcagtcaagca
cggcaaaacgaatttagtgcgttttgtaaacagtacagtgatgtacttgctatgttagaa
accacagagcccacatttgaatattacctccaatggcaagcacacagccaacttacgcaa
tgccaacagcattgtattgcccaagggatggcgattggtttaattaatgatttagcggtg
ggctgtgctaatgagggcactgaatttaaatatcagcagggattatttagtcaagatgca
acccttggcgcaccaccagatccttgggcacctaacggccaaaattgggggctgccagca
ataaacccgcagcgccttgctgacaataactatcagttttatcgttcactcatacgcgcc
aatatggatgcagtaggcgggttacgaatcgaccatgtaatggcgattaggcgtttgtgg
tggtgtttcataaacaataatacccaagatggctgttatgtgtactacccatttgagcat
ttattagcaattttaaaaattgaatctcatcttaatcaggccatagtaataggcgaagat
ttaggggttgttccaccggaggtaaaagaggcactggttgatagtggcattttctcaaac
agcttattttattttgaaaaacaacaaaatgatgagtttgtaaacagcgatgaccttagc
gatcaatgcctgctgatgatagccaatcatgatgtaccgccatttgtgggctggtggcag
catagcgatttaaaaattaaacagcagtatgggctgattgatactgatgagtatcagcag
ttagttcagcagcgagagcaagagcaacaccggttattacgctttttaaacccacaaaac
acttccttgtcacttaacacggatgcttttgacgtttatagcactttggctgtatgttta
gctaaatcgccgtctcgtttatttgcattacagcttgatgatttagacaagcaacactac
ccagtcaatattcctggcaccgataaagagtatcctaattggcgacgggtactcacacat
acgtgcgacgatatttttaaagataatgctgctcttttggctgcaatacattcaataagg
aatgcgtaa

DBGET integrated database retrieval system